Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.73
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6UY27 B2RNZ2 B7ZMG4
Symbols PATE-M
UNQ3112
C11orf38

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MLVLFLLGTVFLLCPYWGELHDPIKATEIMCYECKKYHLGLCYGVMTSCSLKHKQSCAVENFYILTRKGQ      1 - 70
SMYHYSKLSCMTSCEDINFLGFTKRVELICCDHSNYCNLPEGV                                71 - 113
//

Text Mined References (6)

PMID Year Title