Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.73
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
22402205 PATE proteins are involved in sperm-oolemma fusion and penetration but not sperm-zona binding.
22082156 Knockdown of prostate and testis expressed 2 (PATE2) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
18387948 analysis of PATE, expressed primarily in prostate and less in testis, and additional PATE-like genes PATE-M, PATE-DJ, and PATE-B

AA Sequence

MLVLFLLGTVFLLCPYWGELHDPIKATEIMCYECKKYHLGLCYGVMTSCSLKHKQSCAVENFYILTRKGQ      1 - 70
SMYHYSKLSCMTSCEDINFLGFTKRVELICCDHSNYCNLPEGV                                71 - 113
//

Text Mined References (6)

PMID Year Title
22402205 2012 Involvement of the prostate and testis expression (PATE)-like proteins in sperm-oocyte interaction.
18387948 2008 PATE gene clusters code for multiple, secreted TFP/Ly-6/uPAR proteins that are expressed in reproductive and neuron-rich tissues and possess neuromodulatory activity.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.