Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.58
PubTator Score 1.61

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 3.09460227939693E-49
Disease Target Count Z-score Confidence
Essential tremor 30 3.836 1.9


  Differential Expression (1)

Disease log2 FC p
psoriasis -2.400 0.000


Accession Q6UY18
Symbols LRRN6D


  Ortholog (7)

Gene RIF (1)

22104011 variants in coding region of the LINGO4 gene may play little or no role in the risk of Essential tremor susceptibility

AA Sequence

KGRVKHHMTFDFVAPRPSGDKNSGGNRVTAKLF                                         561 - 593

Text Mined References (4)

PMID Year Title
22104011 2012 No evidence of association between the LINGO4 gene and essential tremor in Chinese Han patients.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.