Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.58
PubTator Score 1.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Essential tremor 30 3.836 1.9
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.400 0.000

Gene RIF (1)

PMID Text
22104011 variants in coding region of the LINGO4 gene may play little or no role in the risk of Essential tremor susceptibility

AA Sequence

MDAATAPKQAWPPWPPLLFLLLLPGGSGGSCPAVCDCTSQPQAVLCGHRQLEAVPGGLPLDTELLDLSGN      1 - 70
RLWGLQQGMLSRLSLLQELDLSYNQLSTLEPGAFHGLQSLLTLRLQGNRLRIMGPGVFSGLSALTLLDLR     71 - 140
LNQIVLFLDGAFGELGSLQKLEVGDNHLVFVAPGAFAGLAKLSTLTLERCNLSTVPGLALARLPALVALR    141 - 210
LRELDIGRLPAGALRGLGQLKELEIHLWPSLEALDPGSLVGLNLSSLAITRCNLSSVPFQALYHLSFLRV    211 - 280
LDLSQNPISAIPARRLSPLVRLQELRLSGACLTSIAAHAFHGLTAFHLLDVADNALQTLEETAFPSPDKL    281 - 350
VTLRLSGNPLTCDCRLLWLLRLRRHLDFGMSPPACAGPHHVQGKSLKEFSDILPPGHFTCKPALIRKSGP    351 - 420
RWVIAEEGGHAVFSCSGDGDPAPTVSWMRPHGAWLGRAGRVRVLEDGTLEIRSVQLRDRGAYVCVVSNVA    421 - 490
GNDSLRTWLEVIQVEPPNGTLSDPNITVPGIPGPFFLDSRGVAMVLAVGFLPFLTSVTLCFGLIALWSKG    491 - 560
KGRVKHHMTFDFVAPRPSGDKNSGGNRVTAKLF                                         561 - 593
//

Text Mined References (4)

PMID Year Title
22104011 2012 No evidence of association between the LINGO4 gene and essential tremor in Chinese Han patients.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.