Property Summary

NCBI Gene PubMed Count 33
PubMed Score 21.77
PubTator Score 24.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.500 8.2e-04
Astrocytoma, Pilocytic 1.400 7.2e-04
atypical teratoid / rhabdoid tumor 3.500 2.9e-05
colon cancer -1.800 7.0e-05
ductal carcinoma in situ -1.600 4.2e-03
ependymoma 2.600 1.8e-04
glioblastoma 2.000 4.3e-06
invasive ductal carcinoma -1.307 4.9e-03
lung cancer -1.600 1.6e-04
lung carcinoma -1.300 6.0e-16
non-small cell lung cancer -2.434 6.1e-24

 CSPA Cell Line (3)

Gene RIF (14)

AA Sequence

MENWTGRPWLYLLLLLSLPQLCLDQEVLSGHSLQTPTEEGQGPEGVWGPWVQWASCSQPCGVGVQRRSRT      1 - 70
CQLPTVQLHPSLPLPPRPPRHPEALLPRGQGPRPQTSPETLPLYRTQSRGRGGPLRGPASHLGREETQEI     71 - 140
RAARRSRLRDPIKPGMFGYGRVPFALPLHRNRRHPRSPPRSELSLISSRGEEAIPSPTPRAEPFSANGSP    141 - 210
QTELPPTELSVHTPSPQAEPLSPETAQTEVAPRTRPAPLRHHPRAQASGTEPPSPTHSLGEGGFFRASPQ    211 - 280
PRRPSSQGWASPQVAGRRPDPFPSVPRGRGQQGQGPWGTGGTPHGPRLEPDPQHPGAWLPLLSNGPHASS    281 - 350
LWSLFAPSSPIPRCSGESEQLRACSQAPCPPEQPDPRALQCAAFNSQEFMGQLYQWEPFTEVQGSQRCEL    351 - 420
NCRPRGFRFYVRHTEKVQDGTLCQPGAPDICVAGRCLSPGCDGILGSGRRPDGCGVCGGDDSTCRLVSGN    421 - 490
LTDRGGPLGYQKILWIPAGALRLQIAQLRPSSNYLALRGPGGRSIINGNWAVDPPGSYRAGGTVFRYNRP    491 - 560
PREEGKGESLSAEGPTTQPVDVYMIFQEENPGVFYQYVISSPPPILENPTPEPPVPQLQPEILRVEPPLA    561 - 630
PAPRPARTPGTLQRQVRIPQMPAPPHPRTPLGSPAAYWKRVGHSACSASCGKGVWRPIFLCISRESGEEL    631 - 700
DERSCAAGARPPASPEPCHGTPCPPYWEAGEWTSCSRSCGPGTQHRQLQCRQEFGGGGSSVPPERCGHLP    701 - 770
RPNITQSCQLRLCGHWEVGSPWSQCSVRCGRGQRSRQVRCVGNNGDEVSEQECASGPPQPPSREACDMGP    771 - 840
CTTAWFHSDWSSKCSAECGTGIQRRSVVCLGSGAALGPGQGEAGAGTGQSCPTGSRPPDMRACSLGPCER    841 - 910
TWRWYTGPWGECSSECGSGTQRRDIICVSKLGTEFNVTSPSNCSHLPRPPALQPCQGQACQDRWFSTPWS    911 - 980
PCSRSCQGGTQTREVQCLSTNQTLSTRCPPQLRPSRKRPCNSQPCSQRPDDQCKDSSPHCPLVVQARLCV    981 - 1050
YPYYTATCCRSCAHVLERSPQDPS                                                 1051 - 1074
//

Text Mined References (34)

PMID Year Title