Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.46
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 4.2e-08
malignant mesothelioma 3232 1.0e-05
diabetes mellitus 1728 1.3e-03

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.100 1.3e-03
malignant mesothelioma 1.200 1.0e-05
osteosarcoma 1.582 4.2e-08

Gene RIF (1)

AA Sequence

MPSGCRCLHLVCLLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGT      1 - 70
CHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGS     71 - 140
PCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCT    141 - 210
INLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPH    211 - 280
SAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHYA    281 - 350
PACQDQECQVSMLPAGLPLPRDLPPEPGKTTAL                                         351 - 383
//

Text Mined References (10)

PMID Year Title