Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.82
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
osteosarcoma 1.582 0.000
diabetes mellitus 1.100 0.001

Gene RIF (1)

PMID Text
17320102 Studies in mouse showed that dlk2, highly homologous to dlk1 (also known as pref-1, and FA-1) appears to modulate adipogenesis in vitro in an opposite way to that of dlk1.

AA Sequence

MPSGCRCLHLVCLLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGT      1 - 70
CHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGS     71 - 140
PCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCT    141 - 210
INLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPH    211 - 280
SAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHYA    281 - 350
PACQDQECQVSMLPAGLPLPRDLPPEPGKTTAL                                         351 - 383
//

Text Mined References (10)

PMID Year Title
25093684 2014 The proteins DLK1 and DLK2 modulate NOTCH1-dependent proliferation and oncogenic potential of human SK-MEL-2 melanoma cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
17320102 2007 The novel gene EGFL9/Dlk2, highly homologous to Dlk1, functions as a modulator of adipogenesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.