Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Gene RIF (2)

PMID Text
23358633 conclude that CEACAM20 and CEACAM1 not only mark the lumina of adult prostate tissue but also play a critical role in the vitro generation of prostate organoids
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGPADSWGHHWMGILLSASLCTVWSPPAAAQLTLNANPLDATQSEDVVLPVFGTPRTPQIHGRSRELAKP      1 - 70
SIAVSPGTAIEQKDMVTFYCTTKDVNITIHWVSNNLSIVFHERMQLSKDGKILTILIVQREDSGTYQCEA     71 - 140
RDALLSQRSDPIFLDVKYGPDPVEIKLESGVASGEVVEVMEGSSMTFLAETKSHPPCAYTWFLLDSILSH    141 - 210
TTRTFTIHAVSREHEGLYRCLVSNSATHLSSLGTLKVRVLETLTMPQVVPSSLNLVENARSVDLTCQTVN    211 - 280
QSVNVQWFLSGQPLLPSEHLQLSADNRTLIIHGLQRNDTGPYACEVWNWGSRARSEPLELTINYGPDQVH    281 - 350
ITRESASEMISTIEAELNSSLTLQCWAESKPGAEYRWTLEHSTGEHLGEQLIIRALTWEHDGIYNCTASN    351 - 420
SLTGLARSTSVLVKVVGPQSSSLSSGAIAGIVIGILAVIAVASELGYFLCIRNARRPSRKTTEDPSHETS    421 - 490
QPIPKEEHPTEPSSESLSPEYCNISQLQGRIRVELMQPPDLPEETYETKLPSASRRGNSFSPWKPPPKPL    491 - 560
MPPLRLVSTVPKNMESIYEVLGMQQ                                                 561 - 585
//

Text Mined References (4)

PMID Year Title
23358633 2013 Role of CEACAM1 and CEACAM20 in an in vitro model of prostate morphogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16139472 2005 Identification of a novel group of evolutionarily conserved members within the rapidly diverging murine Cea family.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.