Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.96
PubTator Score 10.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -3.000 2.0e-05
astrocytic glioma -1.800 1.7e-02
Astrocytoma, Pilocytic -2.200 9.1e-05
atypical teratoid / rhabdoid tumor -3.700 7.2e-07
ependymoma -2.800 7.5e-03
facioscapulohumeral dystrophy 2.600 1.1e-04
glioblastoma -2.100 5.2e-04
group 4 medulloblastoma 2.800 9.4e-06
medulloblastoma, large-cell -3.000 1.7e-04
oligodendroglioma -2.300 1.0e-02
ovarian cancer -1.400 1.0e-05
pituitary cancer 1.600 2.0e-02

Gene RIF (7)

AA Sequence

MGRAAATAGGGGGARRWLPWLGLCFWAAGTAAARGTDNGEALPESIPSAPGTLPHFIEEPDDAYIIKSNP      1 - 70
IALRCKARPAMQIFFKCNGEWVHQNEHVSEETLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWS     71 - 140
HLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPIDSEQDENIDT    141 - 210
RADHNLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSWTEWSACNVRCGRGWQKRSRTCT    211 - 280
NPAPLNGGAFCEGMSVQKITCTSLCPVDGSWEVWSEWSVCSPECEHLRIRECTAPPPRNGGKFCEGLSQE    281 - 350
SENCTDGLCILDKKPLHEIKPQSIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSQSDYGVDVIDSSAL    351 - 420
TGGFQTFNFKTVRQGNSLLLNSAMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNPLSDIKVKVQSSFM    421 - 490
VSLGVSERAEYHGKNHSRTFPHGNNHSFSTMHPRNKMPYIQNLSSLPTRTELRTTGVFGHLGGRLVMPNT    491 - 560
GVSLLIPHGAIPEENSWEIYMSINQGEPSLQSDGSEVLLSPEVTCGPPDMIVTTPFALTIPHCADVSSEH    561 - 630
WNIHLKKRTQQGKWEEVMSVEDESTSCYCLLDPFACHVLLDSFGTYALTGEPITDCAVKQLKVAVFGCMS    631 - 700
CNSLDYNLRVYCVDNTPCAFQEVVSDERHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTAC    701 - 770
QEVPFSRVWCSNRQPLHCAFSLERYTPTTTQLSCKICIRQLKGHEQILQVQTSILESERETITFFAQEDS    771 - 840
TFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLWEARHQ    841 - 910
HDGDLDSLACALEEIGRTHTKLSNISESQLDEADFNYSRQNGL                               911 - 953
//

Text Mined References (14)

PMID Year Title