Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.19
PubTator Score 10.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.800 0.017
ependymoma -3.600 0.000
oligodendroglioma -2.300 0.010
glioblastoma -2.400 0.006
atypical teratoid / rhabdoid tumor -3.700 0.000
medulloblastoma, large-cell -3.000 0.000
adult high grade glioma -3.000 0.000
group 4 medulloblastoma 2.800 0.000
pilocytic astrocytoma -2.200 0.000
ovarian cancer -2.800 0.000
pituitary cancer 1.600 0.020
facioscapulohumeral dystrophy 2.600 0.000

Gene RIF (6)

PMID Text
24691657 Unc5D is thus a newly identified transcriptional target of proapoptotic p53 and may also act upstream of p53 to induce p53dependent apoptosis by phosphorylation at ser15.
24519068 the dependence receptor UNC5H4 may act as a putative tumor suppressor in neuroblastoma.
23778138 UNC5D forms a positive feedback loop with p53 and E2F1 to promote NGF dependence-mediated programmed cell death during neuroblastoma regression.
23589179 UNC5D is a functional tumor suppressor that is frequently downregulated in RCCs due to promoter hypermethylation and LOH.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18402767 UNC5H4 amplifies p53-dependent apoptotic response.

AA Sequence

MGRAAATAGGGGGARRWLPWLGLCFWAAGTAAARGTDNGEALPESIPSAPGTLPHFIEEPDDAYIIKSNP      1 - 70
IALRCKARPAMQIFFKCNGEWVHQNEHVSEETLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWS     71 - 140
HLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPIDSEQDENIDT    141 - 210
RADHNLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSWTEWSACNVRCGRGWQKRSRTCT    211 - 280
NPAPLNGGAFCEGMSVQKITCTSLCPVDGSWEVWSEWSVCSPECEHLRIRECTAPPPRNGGKFCEGLSQE    281 - 350
SENCTDGLCILDKKPLHEIKPQSIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSQSDYGVDVIDSSAL    351 - 420
TGGFQTFNFKTVRQGNSLLLNSAMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNPLSDIKVKVQSSFM    421 - 490
VSLGVSERAEYHGKNHSRTFPHGNNHSFSTMHPRNKMPYIQNLSSLPTRTELRTTGVFGHLGGRLVMPNT    491 - 560
GVSLLIPHGAIPEENSWEIYMSINQGEPSLQSDGSEVLLSPEVTCGPPDMIVTTPFALTIPHCADVSSEH    561 - 630
WNIHLKKRTQQGKWEEVMSVEDESTSCYCLLDPFACHVLLDSFGTYALTGEPITDCAVKQLKVAVFGCMS    631 - 700
CNSLDYNLRVYCVDNTPCAFQEVVSDERHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTAC    701 - 770
QEVPFSRVWCSNRQPLHCAFSLERYTPTTTQLSCKICIRQLKGHEQILQVQTSILESERETITFFAQEDS    771 - 840
TFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLWEARHQ    841 - 910
HDGDLDSLACALEEIGRTHTKLSNISESQLDEADFNYSRQNGL                               911 - 953
//

Text Mined References (13)

PMID Year Title
26235030 2015 Structural Basis of Latrophilin-FLRT-UNC5 Interaction in Cell Adhesion.
24691657 2014 Unc5D regulates p53-dependent apoptosis in neuroblastoma cells.
24519068 2014 Overexpression of the dependence receptor UNC5H4 inhibits cell migration and invasion, and triggers apoptosis in neuroblastoma cell.
23778138 2013 Dependence receptor UNC5D mediates nerve growth factor depletion-induced neuroblastoma regression.
23589179 2013 The tumor-suppressive function of UNC5D and its repressed expression in renal cell carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18402767 2008 A newly identified dependence receptor UNC5H4 is induced during DNA damage-mediated apoptosis and transcriptional target of tumor suppressor p53.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
More...