Property Summary

NCBI Gene PubMed Count 6
PubMed Score 9.90
PubTator Score 4.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Gastroenteritis 41 4.046 2.0

Expression

Gene RIF (2)

AA Sequence

MWLSPSLLLLILPGYSIAAKITGPTTVNGSEQGSLTVQCAYGSGWETYLKWRCQGADWNYCNILVKTNGS      1 - 70
EQEVKKNRVSIRDNQKNHVFTVTMENLKRDDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTA     71 - 140
SLAFTAAATQKTSSPLTRSPLKSTHFLFLFLLELPLLLSMLGTVLWVNRPQRRS                    141 - 194
//

Text Mined References (7)

PMID Year Title