Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.90
PubTator Score 4.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Gastroenteritis 46 4.075 2.0

Gene RIF (2)

PMID Text
23072861 CD300 molecules are all expressed by DC; CD300b, d, e and f are restricted to different subpopulations of the myeloid DC lineage. They have been shown to regulate DC function both in vitro and in vivo.
22291008 the function of CD300d would be related to the regulation of the expression of other CD300 molecules and the composition of CD300 complexes on the cell surface.

AA Sequence

MWLSPSLLLLILPGYSIAAKITGPTTVNGSEQGSLTVQCAYGSGWETYLKWRCQGADWNYCNILVKTNGS      1 - 70
EQEVKKNRVSIRDNQKNHVFTVTMENLKRDDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTA     71 - 140
SLAFTAAATQKTSSPLTRSPLKSTHFLFLFLLELPLLLSMLGTVLWVNRPQRRS                    141 - 194
//

Text Mined References (7)

PMID Year Title
23072861 2013 CD300 molecule regulation of human dendritic cell functions.
22291008 2012 Cloning and characterization of CD300d, a novel member of the human CD300 family of immune receptors.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
19592130 2009 The CD300 molecules regulate monocyte and dendritic cell functions.
19359216 2009 The CD300 family of molecules are evolutionarily significant regulators of leukocyte functions.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12483297 2003 Novel immunoglobulin superfamily gene cluster, mapping to a region of human chromosome 17q25, linked to psoriasis susceptibility.