Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.15
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease -1.156 3.2e-02
adult high grade glioma -1.200 7.4e-04
atypical teratoid / rhabdoid tumor -1.200 2.6e-06
facioscapulohumeral dystrophy 1.500 3.1e-02
glioblastoma -1.300 1.3e-05
juvenile dermatomyositis -1.166 1.2e-10
medulloblastoma, large-cell -1.300 9.5e-06
non primary Sjogren syndrome sicca 1.100 1.3e-02
ovarian cancer -1.200 7.4e-06

 GO Function (1)

AA Sequence

MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGERALQSPTSQI      1 - 70
LGEILVQMSDTQRHLNSDLEVVVQTFHGGLLQHMEKNTKLDMQFIKDSRQHYELEYRHRAANLEKCMSEL     71 - 140
WRMERKRDKNVREMKESVNRLHAQMQAFVSESQRAAELEEKRRYRFLAEKHLLLSNTFLQFFGRARGMLQ    141 - 210
NRVLLWKEQSEASRSPSRAHSPGLLGPALGPPYPSGRLTPTCLDMPPRPLGEFSSPRSRHGSGSYGTEPD    211 - 280
ARPASQLEPDRRSLPRTPSASSLYSGSAQSSRSNSFGERPGGGGGARRVRALVSHSEGANHTLLRFSAGD    281 - 350
VVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMNPGNELPSR    351 - 420
SYPLRGSHSLDDLLDRPGNSIAPSEYWDGQSRSRTPSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKK    421 - 490
LMSSEQYPPQELFPRGTNPFATVKLRPTITNDRSAPLIR                                   491 - 529
//

Text Mined References (7)

PMID Year Title