Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.15
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene

PANTHER Protein Class (1)

AA Sequence

MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGERALQSPTSQI      1 - 70
LGEILVQMSDTQRHLNSDLEVVVQTFHGGLLQHMEKNTKLDMQFIKDSRQHYELEYRHRAANLEKCMSEL     71 - 140
WRMERKRDKNVREMKESVNRLHAQMQAFVSESQRAAELEEKRRYRFLAEKHLLLSNTFLQFFGRARGMLQ    141 - 210
NRVLLWKEQSEASRSPSRAHSPGLLGPALGPPYPSGRLTPTCLDMPPRPLGEFSSPRSRHGSGSYGTEPD    211 - 280
ARPASQLEPDRRSLPRTPSASSLYSGSAQSSRSNSFGERPGGGGGARRVRALVSHSEGANHTLLRFSAGD    281 - 350
VVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMNPGNELPSR    351 - 420
SYPLRGSHSLDDLLDRPGNSIAPSEYWDGQSRSRTPSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKK    421 - 490
LMSSEQYPPQELFPRGTNPFATVKLRPTITNDRSAPLIR                                   491 - 529
//

Text Mined References (7)

PMID Year Title
21743456 2011 Pinkbar is an epithelial-specific BAR domain protein that generates planar membrane structures.
21401524 2011 Functional analysis of Dictyostelium IBARa reveals a conserved role of the I-BAR domain in endocytosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.