Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.15
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.23710205205165E-10
atypical teratoid / rhabdoid tumor 4369 2.56366348022096E-6
ovarian cancer 8492 7.4310984352428E-6
medulloblastoma, large-cell 6234 9.49768727370038E-6
glioblastoma 5572 1.2521825442768E-5
pediatric high grade glioma 2712 2.41179110902807E-5
non primary Sjogren syndrome sicca 840 0.0126394265995083
facioscapulohumeral dystrophy 286 0.0308628070121624
active Crohn's disease 918 0.0321572397787567

Expression

  Differential Expression (9)

Gene

PANTHER Protein Class (1)

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

AA Sequence

MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGERALQSPTSQI      1 - 70
LGEILVQMSDTQRHLNSDLEVVVQTFHGGLLQHMEKNTKLDMQFIKDSRQHYELEYRHRAANLEKCMSEL     71 - 140
WRMERKRDKNVREMKESVNRLHAQMQAFVSESQRAAELEEKRRYRFLAEKHLLLSNTFLQFFGRARGMLQ    141 - 210
NRVLLWKEQSEASRSPSRAHSPGLLGPALGPPYPSGRLTPTCLDMPPRPLGEFSSPRSRHGSGSYGTEPD    211 - 280
ARPASQLEPDRRSLPRTPSASSLYSGSAQSSRSNSFGERPGGGGGARRVRALVSHSEGANHTLLRFSAGD    281 - 350
VVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMNPGNELPSR    351 - 420
SYPLRGSHSLDDLLDRPGNSIAPSEYWDGQSRSRTPSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKK    421 - 490
LMSSEQYPPQELFPRGTNPFATVKLRPTITNDRSAPLIR                                   491 - 529
//

Text Mined References (7)

PMID Year Title
21743456 2011 Pinkbar is an epithelial-specific BAR domain protein that generates planar membrane structures.
21401524 2011 Functional analysis of Dictyostelium IBARa reveals a conserved role of the I-BAR domain in endocytosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.