Property Summary

NCBI Gene PubMed Count 29
PubMed Score 36.79
PubTator Score 15.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.300 1.6e-03
astrocytic glioma -2.500 7.1e-03
Astrocytoma, Pilocytic -2.200 1.6e-04
glioblastoma -2.100 1.3e-05
group 3 medulloblastoma -2.200 1.5e-02
lung adenocarcinoma -1.200 2.8e-14
medulloblastoma, large-cell -3.400 6.2e-04
oligodendroglioma -2.000 4.1e-02
Pick disease -1.400 1.2e-02
posterior fossa group A ependymoma 1.500 1.1e-02
primitive neuroectodermal tumor -3.300 4.7e-05

Gene RIF (11)

AA Sequence

MQFRLFSFALIILNCMDYSHCQGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQ      1 - 70
YGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETME     71 - 140
CVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPGGKRTP    141 - 210
KAKEKRNKKKKRKLIERAQEQHSVFLATDRANQ                                         211 - 243
//

Text Mined References (33)

PMID Year Title