Property Summary

NCBI Gene PubMed Count 26
PubMed Score 29.31
PubTator Score 15.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung adenocarcinoma 2714 2.78334272268373E-14
primitive neuroectodermal tumor 3031 4.68734891276138E-5
pilocytic astrocytoma 3086 7.73843705787263E-5
medulloblastoma, large-cell 6234 6.22341521330489E-4
glioblastoma 5572 6.44357805584059E-4
adult high grade glioma 2148 0.00163795353648296
posterior fossa group B ependymoma 1530 0.00170229964164063
astrocytic glioma 2241 0.00705168092933305
Pick disease 1893 0.0120500052868801
group 3 medulloblastoma 2254 0.0149180615100181
oligodendroglioma 2849 0.0413786326934295
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 1.0
ulcerative colitis 2087 0.0 1.0

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.500 0.007
oligodendroglioma -2.000 0.041
glioblastoma -2.700 0.001
group 3 medulloblastoma -2.200 0.015
medulloblastoma, large-cell -3.400 0.001
primitive neuroectodermal tumor -3.300 0.000
adult high grade glioma -2.300 0.002
pilocytic astrocytoma -2.200 0.000
posterior fossa group B ependymoma 1.600 0.002
lung adenocarcinoma -1.200 0.000
Pick disease -1.400 0.012

Synonym

Accession Q6UXX9 B3KVP0 Q4G0U4 Q8N6X6
Symbols CRISTIN2

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (8)

PMID Text
25769727 Wnt(high) cells were more likely to give rise to Wnt(high) progeny, tended to be more metastatic, and revealed higher levels of RSPO2 expression.
24852883 These findings suggest that R-Spondin2 may promote hepatic stellate cell activation by enhancing the canonical Wnt pathway.
24847761 results suggest that the expression of RSPO fusion transcripts is related to a subset of colorectal cancers arising in the Japanese population
24476626 data reveal a RSPO2-induced, LGR5-dependent Wnt signaling-negative feedback loop that exerts a net growth-suppressive effect on CRC cells
23407710 Oocyte-derived R-spondin2 is a paracrine factor essential for primary ovarian follicle development
22895193 using RNA-seq data, identification of multiple fusion transcripts including recurrent gene fusions involving R-spondin family members RSPO2 and RSPO3 that together occur in 10% of colon tumours
22127703 Reduced Rspo-2 levels in osteoarthritis osteoblasts are responsible, at least in part, for their reduced Wnt/beta-catenin signaling and abnormal mineralization.
21160497 There is a role for R-spondin2 in keratinocyte proliferation and epidermal thickening in keloid scarring.

AA Sequence

MQFRLFSFALIILNCMDYSHCQGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQ      1 - 70
YGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETME     71 - 140
CVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPGGKRTP    141 - 210
KAKEKRNKKKKRKLIERAQEQHSVFLATDRANQ                                         211 - 243
//

Text Mined References (30)

PMID Year Title
26635199 2016 Further evidence of the involvement of the Wnt signaling pathway in Dupuytren's disease.
26416247 2015 LGR5 is associated with tumor aggressiveness in papillary thyroid cancer.
26269563 2015 DNA Methylation Predicts Progression of Human Gastric Lesions.
26052033 2015 Roles of miR-196a on gene regulation of neuroendocrine tumor cells.
25769727 2015 RSPO2 Enhances Canonical Wnt Signaling to Confer Stemness-Associated Traits to Susceptible Pancreatic Cancer Cells.
25416956 2014 A proteome-scale map of the human interactome network.
25064007 2014 A genome-wide association study identifies susceptibility loci for ossification of the posterior longitudinal ligament of the spine.
24852883 2014 R-spondin2 activates hepatic stellate cells and promotes liver fibrosis.
24847761 2014 RSPO fusion transcripts in colorectal cancer in Japanese population.
24532711 2014 The R-spondin/Lgr5/Rnf43 module: regulator of Wnt signal strength.
More...