Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.48
PubTator Score 2.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
astrocytic glioma -1.300 0.002
ependymoma -1.500 0.004
oligodendroglioma -1.100 0.004
osteosarcoma -1.130 0.042
pancreatic ductal adenocarcinoma liver m... -1.148 0.014
non-small cell lung cancer 1.017 0.000
lung cancer 2.100 0.000
aldosterone-producing adenoma -1.227 0.019
ovarian cancer 1.100 0.011

Synonym

Accession Q6UXV4 Q3KNU7 Q5H9D1
Symbols Mic27
CXorf33
FAM121A
UNQ8193

Gene

 GO Process (1)

Gene RIF (1)

PMID Text
23704930 APOOL is a cardiolipin-binding component of the Mitofilin/MINOS protein complex.

AA Sequence

MAAIRMGKLTTMPAGLIYASVSVHAAKQEESKKQLVKPEQLPIYTAPPLQSKYVEEQPGHLQMGFASIRT      1 - 70
ATGCYIGWCKGVYVFVKNGIMDTVQFGKDAYVYLKNPPRDFLPKMGVITVSGLAGLVSARKGSKFKKITY     71 - 140
PLGLATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVP    141 - 210
AKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPEDIDMYSTRS                211 - 268
//

Text Mined References (15)

PMID Year Title
25997101 2015 QIL1 is a novel mitochondrial protein required for MICOS complex stability and cristae morphology.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25781180 2015 Detailed analysis of the human mitochondrial contact site complex indicate a hierarchy of subunits.
25764979 2015 The non-glycosylated isoform of MIC26 is a constituent of the mammalian MICOS complex and promotes formation of crista junctions.
24687277 2014 Uniform nomenclature for the mitochondrial contact site and cristae organizing system.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23704930 2013 APOOL is a cardiolipin-binding constituent of the Mitofilin/MINOS protein complex determining cristae morphology in mammalian mitochondria.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
More...