Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.04
PubTator Score 2.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.227 1.9e-02
astrocytic glioma -1.300 2.1e-03
ependymoma -1.500 3.6e-03
lung cancer 1.100 8.1e-03
malignant mesothelioma 1.100 5.9e-06
non-small cell lung cancer 1.017 4.3e-12
oligodendroglioma -1.100 4.0e-03
osteosarcoma -1.130 4.2e-02
ovarian cancer 1.100 1.1e-02
pancreatic ductal adenocarcinoma liver m... -1.148 1.4e-02

Gene RIF (1)

AA Sequence

MAAIRMGKLTTMPAGLIYASVSVHAAKQEESKKQLVKPEQLPIYTAPPLQSKYVEEQPGHLQMGFASIRT      1 - 70
ATGCYIGWCKGVYVFVKNGIMDTVQFGKDAYVYLKNPPRDFLPKMGVITVSGLAGLVSARKGSKFKKITY     71 - 140
PLGLATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVP    141 - 210
AKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPEDIDMYSTRS                211 - 268
//

Text Mined References (15)

PMID Year Title