Knowledge Summary

Patent

No data available

Synonym

Accession Q6UXV3
Symbols

Gene

 GO Component (1)

 Compartment GO Term (2)

AA Sequence

MLPEQGPQPSTMPLWCLLAACTSLPRQAATMLEEAASPNEAVHASTSGSGALTDQTFTDLSAAEASSEEV      1 - 70
PDFMEVPHSVHHKINCFFYLEKQLCQLPSPLCLSSLLTLKLKTTVPAPGRWWSFQPHKAFPLLVGTPGSW     71 - 140
QSTIDPAWAAPSQPSPG                                                         141 - 157
//

Text Mined References (1)

PMID Year Title