Property Summary

NCBI Gene PubMed Count 4
Grant Count 15
R01 Count 6
Funding $1,538,757.2
PubMed Score 9.84
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

AA Sequence

MPLALTLLLLSGLGAPGGWGCLQCDPLVLEALGHLRSALIPSRFQLEQLQARAGAVLMGMEGPFFRDYAL      1 - 70
NVFVGKVETNQLDLVASFVKNQTQHLMGNSLKDEPLLEELVTLRANVIKEFKKVLISYELKACNPKLCRL     71 - 140
LKEEVLDCLHCQRITPKCIHKKYCFVDRQPRVALQYQMDSKYPRNQALLGILISVSLAVFVFVVIVVSAC    141 - 210
TYRQNRKLLLQ                                                               211 - 221
//

Text Mined References (6)

PMID Year Title
22957301 2012 Positive Selection and the Evolution of izumo Genes in Mammals.
19658160 2009 Izumo is part of a multiprotein family whose members form large complexes on mammalian sperm.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.