Property Summary

NCBI Gene PubMed Count 4
PubMed Score 8.84
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

AA Sequence

MPLALTLLLLSGLGAPGGWGCLQCDPLVLEALGHLRSALIPSRFQLEQLQARAGAVLMGMEGPFFRDYAL      1 - 70
NVFVGKVETNQLDLVASFVKNQTQHLMGNSLKDEPLLEELVTLRANVIKEFKKVLISYELKACNPKLCRL     71 - 140
LKEEVLDCLHCQRITPKCIHKKYCFVDRQPRVALQYQMDSKYPRNQALLGILISVSLAVFVFVVIVVSAC    141 - 210
TYRQNRKLLLQ                                                               211 - 221
//

Text Mined References (6)

PMID Year Title