Property Summary

NCBI Gene PubMed Count 3
Grant Count 11
R01 Count 10
Funding $1,250,308.2
PubMed Score 5.64
PubTator Score 12.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

AA Sequence

MIVFIFLAMGLSLENEYTSQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSI      1 - 70
QYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVG     71 - 140
DVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTC    141 - 210
AVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYI    211 - 280
DILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNG    281 - 350
EVIYAAMCMTVTCGILLLVMVKLRTSRISSKARDPSSIQIPGEL                              351 - 394
//

Text Mined References (4)

PMID Year Title
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16086688 2005 Identification, expression and functional characterization of the GRAL gene.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.