Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 1.2e-03
ductal carcinoma in situ -1.100 1.1e-02
ependymoma 1.300 3.8e-06
glioblastoma 1.100 1.9e-02
invasive ductal carcinoma -1.200 3.7e-02
medulloblastoma, large-cell 1.200 3.1e-04
osteosarcoma -1.083 6.6e-03

Synonym

Accession Q6UXT9 Q96EC5
Symbols

Gene

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MPPWGAALALILAVLALLGLLGPRLRGPWGRAVGERTLPGAQDRDDGEEADGGGPADQFSDGREPLPGGC      1 - 70
SLVCKPSALAQCLLRALRRSEALEAGPRSWFSGPHLQTLCHFVLPVAPGPELAREYLQLADDGLVALDWV     71 - 140
VGPCVRGRRITSAGGLPAVLLVIPNAWGRLTRNVLGLCLLALERGYYPVIFHRRGHHGCPLVSPRLQPFG    141 - 210
DPSDLKEAVTYIRFRHPAAPLFAVSEGSGSALLLSYLGECGSSSYVTGAACISPVLRCREWFEAGLPWPY    211 - 280
ERGFLLHQKIALSRYATALEDTVDTSRLFRSRSLREFEEALFCHTKSFPISWDTYWDRNDPLRDVDEAAV    281 - 350
PVLCICSADDPVCGPPDHTLTTELFHSNPYFFLLLSRHGGHCGFLRQEPLPAWSHEVILESFRALTEFFR    351 - 420
TEERIKGLSRHRASFLGGRRRGGALQRREVSSSSNLEEIFNWKRSYTR                          421 - 468
//

Text Mined References (7)

PMID Year Title