Property Summary

NCBI Gene PubMed Count 30
Grant Count 68
R01 Count 49
Funding $6,878,435.97
PubMed Score 347.68
PubTator Score 32.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.200 0.000
non-small cell lung carcinoma -1.500 0.000

Synonym

Accession Q6UXS9 D6RBN7 CASP-12
Symbols CASP-12
CASP12P1

Gene

 GO Component (1)

 IMPC Term (1)

Gene RIF (24)

PMID Text
26582949 Expression of caspase-12 was linked to decreased systemic and adipose tissue inflammation in a cohort of African American obese children.
26261584 Endoplasmic reticulum stress related factor ATF6 and caspase-12 trigger apoptosis in neonatal hypoxic-ischemic encephalopathy.
25503380 We found that RNA interference-induced Caspase-12 silencing increased NOD1, hBD1 and hBD2 expression
24586588 conclude that the functional CASP12L allele is not a marker for susceptibility and/or severity of CAP
24515649 Distribution of CASP12 alleles (#rs497116) in African-Americans (AA) with rheumatoid arthritis (RA). There was no difference in the overall distribution of genotypes within AA with RA, but homozygous patients had lower baseline joint-narrowing scores.
24224909 EtOH-induced activation of caspase-12 could be one of the underlying mechanisms of hepatocyte apoptosis.
21872999 examines the role that CASP12 plays in down-regulating inflammation, we hypothesize that pathogens which exploit the inflammatory response are restrained by an active CASP12 gene product
21706251 CASPASE-12 does not influence the susceptibility to Candida sepsis, nor has any effect on the serum cytokine concentrations in Candida sepsis patients during the course of infection.
20646990 Constitutively active forms of caspase-12 (rev-Deltapro1 and rev-Deltapro2) could induce cell death in cells transfected with the corresponding expression vectors.
20577092 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MADEKPSNGVLVHMVKLLIKTFLDGIFDDLMENNVLNTDEIHLIGKCLKFVVSNAENLVDDITETAQTAG      1 - 70
KIFREHLWNSKKQLSSDISSDGEREANMPGLNIRNKEFNYLHNRNGSELDLLGMRDLLENLGYSVVIKEN     71 - 140
LTAQEMETALRQFAAHPEHQSSDSTFLVFMSHSILNGICGTKHWDQEPDVLHDDTIFEIFNNRNCQSLKD    141 - 210
KPKVIIMQACRGNGAGIVWFTTDSGKAGADTHGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHE    211 - 280
TNGSVFISQIIYYFREYSWSHHLEEIFQKVQHSFETPNILTQLPTIERLSMTRYFYLFPGN             281 - 341
//

Text Mined References (31)

PMID Year Title
26582949 2016 Caspase-12, but Not Caspase-11, Inhibits Obesity and Insulin Resistance.
26261584 2015 ER stress related factor ATF6 and caspase-12 trigger apoptosis in neonatal hypoxic-ischemic encephalopathy.
25503380 2014 Caspase-12 silencing attenuates inhibitory effects of cigarette smoke extract on NOD1 signaling and hBDs expression in human oral mucosal epithelial cells.
24586588 2014 Lack of association of the caspase-12 long allele with community-acquired pneumonia in people of African descent.
24515649 2014 CASPASE-12 and rheumatoid arthritis in African-Americans.
24224909 2014 The resveratrol attenuates ethanol-induced hepatocyte apoptosis via inhibiting ER-related caspase-12 activation and PDE activity in vitro.
21872999 2011 A possible mechanism for maintenance of the deleterious allele of human CASPASE-12.
21706251 2012 The impact of caspase-12 on susceptibility to candidemia.
20646990 2010 Purification of catalytically active caspase-12 and its biochemical characterization.
20577092 2010 Genetic variation of innate immune genes in HIV-infected african patients with or without oropharyngeal candidiasis.
More...