Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

AA Sequence

MQRWTLWAAAFLTLHSAQAFPQTDISISPALPELPLPSLCPLFWMEFKGHCYRFFPLNKTWAEADLYCSE      1 - 70
FSVGRKSAKLASIHSWEENVFVYDLVNSCVPGIPADVWTGLHDHRQVRKQWPLGPLGSSSQDSILI         71 - 136
//

Text Mined References (3)

PMID Year Title