Knowledge Summary

Patent

No data available

Synonym

Accession Q6UXR8
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MEPWWPRGTGANAPWVLVAVPPGLFPSLLGACCTLTSSSWLQPRFWGLGWRVEVGLEGAGGSSQNYQAAL      1 - 70
PSFFCLAASPASRPAIFGILAAEPPSASPQAPWPKPGCASPHGSHWPSILIC                       71 - 122
//

Text Mined References (1)

PMID Year Title