Knowledge Summary

Patent

No data available

Synonym

Accession Q6UXR6
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MQCWQQPFLRFLQQPFFLATASLAGSSSSFNVLIPKRDEDGDGEGPGDVTAGVSRAAGSPSGWEAPWVQQ      1 - 70
PRCCRRATPVCCAGQGPPRSLQQGGSEVLLGQLCSPEPDWLPSSGPKVAKQVFQVAAELLQHPEHFVPSS     71 - 140
VPEGCVHKPGSTCDGSLKGRAYPSCVPKRDPEHSREESHPLSG                               141 - 183
//

Text Mined References (1)

PMID Year Title