Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 0.64

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
21903150 results of our study of Chinese elderly males without dementia did not support the findings in a UK elderly population that polymorphism in the LMNA and near a SERPINA13 gene may affect cognitive function in the elderly.
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEASRWWLLVTVLMAGAHCVALVDQEASDLIHSGPQDSSPGPALPCHKISVSNIDFAFKLYRQLALNAPG      1 - 70
ENILFFPVSISLALAMLSWGAPVASRTQLLEGLGFTLTVVPEEEIQEGFWDLLIRLRGQGPRLLLTMDQR     71 - 140
RFSGLGARANQSLEEAQKHIDEYTEQQTQGKLGAWEKDLGSETTAVLVNHMLLRAEWMKPFDSHATSPKE    141 - 210
FFVDEHSAVWVPMMKEKASHRFLHDRELQCSVLRMDHAGNTTTFFIFPNRGKMRHLEDALLPETLIKWDS    211 - 280
LLRTRELDFHFPKFSISRTCRLEMLLP                                               281 - 307
//

Text Mined References (9)

PMID Year Title
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
21903150 2011 Polymorphisms in LMNA and near a SERPINA13 gene are not associated with cognitive performance in Chinese elderly males without dementia.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16395595 2006 Human-specific nonsense mutations identified by genome sequence comparisons.
15769666 2005 Organization and expression of the human serpin gene cluster at 14q32.1.
15014966 2004 Sequence organization and matrix attachment regions of the human serine protease inhibitor gene cluster at 14q32.1.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.