Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.05

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6UXP7 A2RRE4
Symbols UNQ9217

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MAASAGGPGSWSENILEYFLRNSQITAEDGAEITWYHAANHKAQTNEALKSTAHMIEADVLLPSDGSEHS      1 - 70
QPIMAHPPETNSDNTLQEWLTEVMKSNKGIKLDFKSLAVVEPSMMLLENVKRHLKRPVWINADILPGPNG     71 - 140
NSKVIDAKPFLDTVISFFPDVTFSLGWTTGWHPEKVNEGYSWTMVKEMEYICNELSQPVTFPVRAALVRQ    141 - 210
SCSQLLWLLKKSNRYSLTIWTGKNDNYSVEDLLYIRDHFDKKQVFYDILEPQNHEFKQAIGIKVNL        211 - 276
//

Text Mined References (6)

PMID Year Title