Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.05

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAASAGGPGSWSENILEYFLRNSQITAEDGAEITWYHAANHKAQTNEALKSTAHMIEADVLLPSDGSEHS      1 - 70
QPIMAHPPETNSDNTLQEWLTEVMKSNKGIKLDFKSLAVVEPSMMLLENVKRHLKRPVWINADILPGPNG     71 - 140
NSKVIDAKPFLDTVISFFPDVTFSLGWTTGWHPEKVNEGYSWTMVKEMEYICNELSQPVTFPVRAALVRQ    141 - 210
SCSQLLWLLKKSNRYSLTIWTGKNDNYSVEDLLYIRDHFDKKQVFYDILEPQNHEFKQAIGIKVNL        211 - 276
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7937745 1994 Construction and characterization of a normalized cDNA library.