Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.33

Knowledge Summary

Patent

No data available

AA Sequence

MQMDPGPQVPLYWLGFVYAALAALGGISGYAKVGSVQSPSAGFFFSELAGLDASQPSRNPKEHLSSPVYI      1 - 70
WDLARYYANKILTLWNIYACGFSCRCLLIVSKLGSMYGEQILSVVAMSQLGLMKN                    71 - 125
//

Text Mined References (2)

PMID Year Title
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.