Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.50
PubTator Score 4.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 4.0e-03

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 4.0e-03

Synonym

Accession Q6UXN9 A8K5R5 Q8TEB2
Symbols SWD2
MST107
WDR82A
MSTP107
PRO2730
TMEM113
PRO34047

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 GO Function (1)

Gene RIF (5)

AA Sequence

MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIR      1 - 70
YTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPN     71 - 140
CQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLIL    141 - 210
ISTNGSFIRLIDAFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGK    211 - 280
HTGPITCLQFNPKFMTFASACSNMAFWLPTIDD                                         281 - 313
//

Text Mined References (15)

PMID Year Title