Property Summary

NCBI Gene PubMed Count 13
Grant Count 6
R01 Count 5
Funding $431,814.89
PubMed Score 10.09
PubTator Score 4.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 0.004

Synonym

Accession Q6UXN9 A8K5R5 Q8TEB2
Symbols SWD2
MST107
WDR82A
MSTP107
PRO2730
TMEM113
PRO34047

Gene

PANTHER Protein Class (2)

 GO Function (1)

 GO Process (1)

Gene RIF (5)

PMID Text
26519536 these findings demonstrate that WDR82 is a negative regulator of virus-triggered type I IFNs pathway through mediating TRAF3 polyubiquitination status and stability on mitochondria.
23110726 Depletion of WD repeat domain 82 (WDR82) by siRNA enhances HIV-1 Tat activation of HIV-1 LTR, which is not the results of increased Tat expression and release of CDK9/CCNT1 from 7SK snRNP, and activation of NF-kappaB
20516061 mammalian Wdr82 functions in a variety of cellular processes; PTW/PP1 phosphatase complex (PNUTS, Tox4, Wdr82, PP1) has a role in the regulation of chromatin structure during the transition from mitosis into interphase
18838538 Data show that Wdr82, which associates with chromatin in a histone H2B ubiquitination-dependent manner, is a specific component of Set1 complexes but not that of MLL1-4 complexes.
17998332 suggest a model for how the mammalian RNA polymerase II machinery is linked with histone H3-Lys4 histone methyltransferase complexes at transcriptionally active genes

AA Sequence

MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIR      1 - 70
YTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPN     71 - 140
CQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLIL    141 - 210
ISTNGSFIRLIDAFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGK    211 - 280
HTGPITCLQFNPKFMTFASACSNMAFWLPTIDD                                         281 - 313
//

Text Mined References (15)

PMID Year Title
26519536 2015 WDR82 Negatively Regulates Cellular Antiviral Response by Mediating TRAF3 Polyubiquitination in Multiple Cell Lines.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21269460 2011 Initial characterization of the human central proteome.
20516061 2010 Identification and characterization of a novel human PP1 phosphatase complex.
18838538 2008 Molecular regulation of H3K4 trimethylation by Wdr82, a component of human Set1/COMPASS.
17998332 2008 Wdr82 is a C-terminal domain-binding protein that recruits the Setd1A Histone H3-Lys4 methyltransferase complex to transcription start sites of transcribed human genes.
17355966 2007 Identification and characterization of the human Set1B histone H3-Lys4 methyltransferase complex.
More...