Tbio | WD repeat-containing protein 82 |
Regulatory component of the SET1 complex implicated in the tethering of this complex to transcriptional start sites of active genes. Facilitates histone H3 'Lys-4' methylation via recruitment of the SETD1A or SETD1B to the 'Ser-5' phosphorylated C-terminal domain (CTD) of RNA polymerase II large subunit (POLR2A). Component of PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.
TMEM113 (WDR82) is a component of the mammalian SET1A (MIM 611052)/SET1B (MIM 611055) histone H3-Lys4 methyltransferase complexes (Lee and Skalnik, 2005 [PubMed 16253997]; Lee et al., 2007 [PubMed 17355966]).[supplied by OMIM, Jul 2010]
TMEM113 (WDR82) is a component of the mammalian SET1A (MIM 611052)/SET1B (MIM 611055) histone H3-Lys4 methyltransferase complexes (Lee and Skalnik, 2005 [PubMed 16253997]; Lee et al., 2007 [PubMed 17355966]).[supplied by OMIM, Jul 2010]
Comments
Species | Source |
---|---|
Macaque | OMA Inparanoid |
Mouse | OMA Inparanoid |
Platypus | OMA Inparanoid |
Chicken | OMA Inparanoid |
Anole lizard | OMA Inparanoid |
C. elegans | OMA Inparanoid |
Fruitfly | OMA Inparanoid |
S.cerevisiae | OMA Inparanoid |
PMID | Text |
---|---|
26519536 | these findings demonstrate that WDR82 is a negative regulator of virus-triggered type I IFNs pathway through mediating TRAF3 polyubiquitination status and stability on mitochondria. |
23110726 | Depletion of WD repeat domain 82 (WDR82) by siRNA enhances HIV-1 Tat activation of HIV-1 LTR, which is not the results of increased Tat expression and release of CDK9/CCNT1 from 7SK snRNP, and activation of NF-kappaB |
20516061 | mammalian Wdr82 functions in a variety of cellular processes; PTW/PP1 phosphatase complex (PNUTS, Tox4, Wdr82, PP1) has a role in the regulation of chromatin structure during the transition from mitosis into interphase |
18838538 | Data show that Wdr82, which associates with chromatin in a histone H2B ubiquitination-dependent manner, is a specific component of Set1 complexes but not that of MLL1-4 complexes. |
17998332 | suggest a model for how the mammalian RNA polymerase II machinery is linked with histone H3-Lys4 histone methyltransferase complexes at transcriptionally active genes |
MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIR 1 - 70 YTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPN 71 - 140 CQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLIL 141 - 210 ISTNGSFIRLIDAFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGK 211 - 280 HTGPITCLQFNPKFMTFASACSNMAFWLPTIDD 281 - 313 //
PMID | Year | Title |
---|---|---|
26519536 | 2015 | WDR82 Negatively Regulates Cellular Antiviral Response by Mediating TRAF3 Polyubiquitination in Multiple Cell Lines. |
24270157 | 2013 | A quantitative telomeric chromatin isolation protocol identifies different telomeric states. |
23974872 | 2013 | Genome-wide association analysis identifies 13 new risk loci for schizophrenia. |
22814378 | 2012 | N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. |
21926972 | 2011 | Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4. |
21269460 | 2011 | Initial characterization of the human central proteome. |
20516061 | 2010 | Identification and characterization of a novel human PP1 phosphatase complex. |
18838538 | 2008 | Molecular regulation of H3K4 trimethylation by Wdr82, a component of human Set1/COMPASS. |
17998332 | 2008 | Wdr82 is a C-terminal domain-binding protein that recruits the Setd1A Histone H3-Lys4 methyltransferase complex to transcription start sites of transcribed human genes. |
17355966 | 2007 | Identification and characterization of the human Set1B histone H3-Lys4 methyltransferase complex. |
More... |