Property Summary

NCBI Gene PubMed Count 15
PubMed Score 48.13
PubTator Score 18.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

Gene RIF (15)

AA Sequence

MHEEEIYTSLQWDSPAPDTYQKCLSSNKCSGACCLVMVISCVFCMGLLTASIFLGVKLLQVSTIAMQQQE      1 - 70
KLIQQERALLNFTEWKRSCALQMKYCQAFMQNSLSSAHNSSPCPNNWIQNRESCYYVSEIWSIWHTSQEN     71 - 140
CLKEGSTLLQIESKEEMDFITGSLRKIKGSYDYWVGLSQDGHSGRWLWQDGSSPSPGLLPAERSQSANQV    141 - 210
CGYVKSNSLLSSNCSTWKYFICEKYALRSSV                                           211 - 241
//

Text Mined References (15)

PMID Year Title