Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6UXN7 B2RPR0
Symbols UNQ9438

Gene

PANTHER Protein Class (1)

AA Sequence

MPSVRSLLRLLAAAAACGAFAFLGYCIYLNRKRRGDPAFKRRLRDKRRAEPQKAEEQGTQLWDPTKNKKL      1 - 70
QELFLQEVRMGELWLSRGEHRMGIQHLGNALLVCEQPRELLKVFKHTLPPKVFEMLLHKIPLICQQFEAD     71 - 140
MNEQDCLEDDPD                                                              141 - 152
//

Text Mined References (4)

PMID Year Title
15733919 2005 Patterns that define the four domains conserved in known and novel isoforms of the protein import receptor Tom20.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.