Property Summary

NCBI Gene PubMed Count 6
Grant Count 5
Funding $1,127,575.04
PubMed Score 3.73
PubTator Score 2.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.013 0.001
diabetes mellitus 1.200 0.002
ovarian cancer -1.100 0.000
psoriasis 2.400 0.000

Gene RIF (2)

PMID Text
24975946 determined by von Kossa staining that TREML4 colocalizes with areas of microcalcification within coronary plaques. Overall, we present integrative RNA, DNA, and protein evidence implicating TREML4 in coronary artery calcification
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAWGGVHTCCFHLCCCCSWPQGAVPEELHKHPGQTLLLQCQYSPKRGPYQPKSWCQQTSPSRCTLLVTSS      1 - 70
KPWTAVQKSHYTIWDKPNAGFFNITMIQLTQNDSGFYWCGIYNASENIITVLRNISLVVSPAPTTSPMWT     71 - 140
LPWLPTSTVLITSPEGTSGHPSINGSETRKSRAPACLGSGGPRFLVLVLCGLLLAKGLML              141 - 200
//

Text Mined References (7)

PMID Year Title
24975946 2014 Integrative DNA, RNA, and protein evidence connects TREML4 to coronary artery calcification.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12645956 2003 The human TREM gene cluster at 6p21.1 encodes both activating and inhibitory single IgV domain receptors and includes NKp44.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.