Property Summary

NCBI Gene PubMed Count 26
PubMed Score 15.57
PubTator Score 20.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.700 6.5e-03
atypical teratoid / rhabdoid tumor 1.300 6.7e-04
Breast cancer -1.800 1.8e-05
ependymoma 2.700 9.5e-14
glioblastoma 1.400 1.6e-02
interstitial cystitis -1.100 3.7e-03
invasive ductal carcinoma -1.300 4.3e-02
lung adenocarcinoma 1.200 5.7e-07
medulloblastoma 1.100 2.9e-02
medulloblastoma, large-cell 2.200 2.2e-02
nasopharyngeal carcinoma 1.100 1.5e-02
non-small cell lung cancer 1.438 2.4e-14
osteosarcoma 2.291 1.1e-02
ovarian cancer -1.200 2.3e-02
primitive neuroectodermal tumor 1.100 3.9e-02

Gene RIF (19)

AA Sequence

MSAPSLRARAAGLGLLLCAVLGRAGRSDSGGRGELGQPSGVAAERPCPTTCRCLGDLLDCSRKRLARLPE      1 - 70
PLPSWVARLDLSHNRLSFIKASSMSHLQSLREVKLNNNELETIPNLGPVSANITLLSLAGNRIVEILPEH     71 - 140
LKEFQSLETLDLSSNNISELQTAFPALQLKYLYLNSNRVTSMEPGYFDNLANTLLVLKLNRNRISAIPPK    141 - 210
MFKLPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITK    211 - 280
GWLYGLLMLQELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYI    281 - 350
ADCAFRGLSSLKTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDN    351 - 420
AIMSLQGNAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQSFVNASCAHPQLLKGRSIFAVSPDG    421 - 490
FVCDDFPKPQITVQPETQSAIKGSNLSFICSAASSSDSPMTFAWKKDNELLHDAEMENYAHLRAQGGEVM    491 - 560
EYTTILRLREVEFASEGKYQCVISNHFGSSYSVKAKLTVNMLPSFTKTPMDLTIRAGAMARLECAAVGHP    561 - 630
APQIAWQKDGGTDFPAARERRMHVMPEDDVFFIVDVKIEDIGVYSCTAQNSAGSISANATLTVLETPSFL    631 - 700
RPLLDRTVTKGETAVLQCIAGGSPPPKLNWTKDDSPLVVTERHFFAAGNQLLIIVDSDVSDAGKYTCEMS    701 - 770
NTLGTERGNVRLSVIPTPTCDSPQMTAPSLDDDGWATVGVVIIAVVCCVVGTSLVWVVIIYHTRRRNEDC    771 - 840
SITNTDETNLPADIPSYLSSQGTLADRQDGYVSSESGSHHQFVTSSGAGFFLPQHDSSGTCHIDNSSEAD    841 - 910
VEAATDLFLCPFLGSTGPMYLKGNVYGSDPFETYHTGCSPDPRTVLMDHYEPSYIKKKECYPCSHPSEES    911 - 980
CERSFSNISWPSHVRKLLNTSYSHNEGPGMKNLCLNKSSLDFSANPEPASVASSNSFMGTFGKALRRPHL    981 - 1050
DAYSSFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERTDFQEENHICTFKQTLENYRTPNFQSYDLDT    1051 - 1119
//

Text Mined References (26)

PMID Year Title