Property Summary

NCBI Gene PubMed Count 20
PubMed Score 35.49
PubTator Score 15.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.308562451707E-8
group 3 medulloblastoma 2254 5.02509356844965E-4
lung adenocarcinoma 2714 7.17211092621292E-4
nasopharyngeal carcinoma 1056 9.00245822760601E-4
pancreatic cancer 2300 0.00224580065593334
cystic fibrosis and chronic rhinosinusitis 213 0.00797532281176432
chronic rhinosinusitis 512 0.0398819897505525
Disease Target Count Z-score Confidence
psoriasis 6685 4.02 2.0

Expression

  Differential Expression (7)

Synonym

Accession Q6UXL0 B4DL40 Q6P438 Q8IYY5 Q8TAJ7 IL-20 receptor subunit beta
Symbols DIRS1
FNDC6
IL-20R2

Gene

PDB

4DOH  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
24455976 Trabecular meshwork cells express IL-20 receptors; Mutation of the T104 residue in IL-20R2 leads to a reduction in STAT3 phosphorylation as well as decreased matrix metalloproteinase activity
22802649 The crystal structure of the IL-20/IL-20R1/IL-20R2 complex reveals how type I and II complexes discriminate cognate from noncognate ligands
22232181 crystallographic asymmetric unit contains one IL-20-IL-20R1-IL-20R2 complex, corresponding to a solvent content of approximately 54%
19666410 Complete mda-7/IL-24 receptors (IL-22R1/IL-20R2 and IL-20R1/IL-20R2) are seldom expressed in liver cancer cell lines.
18480827 The hypotheses that genetic variations of the IL-20-RI influence susceptibility to psoriasis and single nucleotide polymorphisms (SNPs) in the IL20RA and IL20RB genes in psoriasis patients were investigated.
18480827 Observational study of gene-disease association. (HuGE Navigator)
14580208 forms stable complex with interleukin-19 and interleukin-20 [IL-20R1][IL-20R2]

AA Sequence

MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEY      1 - 70
QGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTR     71 - 140
PGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVK    141 - 210
AIGRYSAFSQTECVEVQGEAIPLVLALFAFVGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNS    211 - 280
PQKLISCRREEVDACATAVMSPEELLRAWIS                                           281 - 311
//

Text Mined References (22)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24455976 Interleukin-20 receptor expression in the trabecular meshwork and its implication in glaucoma.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24047446 2013 Genome-wide association study of co-occurring anxiety in major depression.
22802649 2012 Structural basis for receptor sharing and activation by interleukin-20 receptor-2 (IL-20R2) binding cytokines.
22232181 2012 Purification, crystallization and preliminary X-ray diffraction analysis of the IL-20-IL-20R1-IL-20R2 complex.
19666410 2009 Expression pattern of mda-7/IL-24 receptors in liver cancer cell lines.
19043545 2008 Genetics meets metabolomics: a genome-wide association study of metabolite profiles in human serum.
18480827 2008 Association analysis of IL20RA and IL20RB genes in psoriasis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...