Property Summary

NCBI Gene PubMed Count 20
Grant Count 2
Funding $38,182.7
PubMed Score 35.49
PubTator Score 15.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (7)

PMID Text
24455976 Trabecular meshwork cells express IL-20 receptors; Mutation of the T104 residue in IL-20R2 leads to a reduction in STAT3 phosphorylation as well as decreased matrix metalloproteinase activity
22802649 The crystal structure of the IL-20/IL-20R1/IL-20R2 complex reveals how type I and II complexes discriminate cognate from noncognate ligands
22232181 crystallographic asymmetric unit contains one IL-20-IL-20R1-IL-20R2 complex, corresponding to a solvent content of approximately 54%
19666410 Complete mda-7/IL-24 receptors (IL-22R1/IL-20R2 and IL-20R1/IL-20R2) are seldom expressed in liver cancer cell lines.
18480827 The hypotheses that genetic variations of the IL-20-RI influence susceptibility to psoriasis and single nucleotide polymorphisms (SNPs) in the IL20RA and IL20RB genes in psoriasis patients were investigated.
18480827 Observational study of gene-disease association. (HuGE Navigator)
14580208 forms stable complex with interleukin-19 and interleukin-20 [IL-20R1][IL-20R2]

AA Sequence

MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEY      1 - 70
QGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTR     71 - 140
PGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVK    141 - 210
AIGRYSAFSQTECVEVQGEAIPLVLALFAFVGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNS    211 - 280
PQKLISCRREEVDACATAVMSPEELLRAWIS                                           281 - 311
//

Text Mined References (22)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24455976 Interleukin-20 receptor expression in the trabecular meshwork and its implication in glaucoma.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24047446 2013 Genome-wide association study of co-occurring anxiety in major depression.
22802649 2012 Structural basis for receptor sharing and activation by interleukin-20 receptor-2 (IL-20R2) binding cytokines.
22232181 2012 Purification, crystallization and preliminary X-ray diffraction analysis of the IL-20-IL-20R1-IL-20R2 complex.
19666410 2009 Expression pattern of mda-7/IL-24 receptors in liver cancer cell lines.
19043545 2008 Genetics meets metabolomics: a genome-wide association study of metabolite profiles in human serum.
18480827 2008 Association analysis of IL20RA and IL20RB genes in psoriasis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...