Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.99
PubTator Score 3.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
posterior fossa group B ependymoma 2.000 0.000
oligodendroglioma 2.800 0.009
astrocytoma 1.400 0.000
glioblastoma 1.200 0.001
sonic hedgehog group medulloblastoma 2.000 0.000
medulloblastoma, large-cell 1.700 0.015
pancreatic cancer 1.600 0.001
pilocytic astrocytoma 1.400 0.000
lung carcinoma -1.300 0.000
Breast cancer -1.700 0.001
ductal carcinoma in situ 1.800 0.048
ovarian cancer 1.300 0.011
psoriasis -1.100 0.000

Gene RIF (2)

PMID Text
20678249 Observational study of gene-disease association. (HuGE Navigator)
18591937 N-MYC promotes cell proliferation through a direct transactivation of neuronal leucine-rich repeat protein-1 (NLRR1) gene in neuroblastoma.

AA Sequence

MARMSFVIAACQLVLGLLMTSLTESSIQNSECPQLCVCEIRPWFTPQSTYREATTVDCNDLRLTRIPSNL      1 - 70
SSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNIKEVGLANLTQLTTLHLEENQITEMTDYCLQ     71 - 140
DLSNLQELYINHNQISTISAHAFAGLKNLLRLHLNSNKLKVIDSRWFDSTPNLEILMIGENPVIGILDMN    141 - 210
FKPLANLRSLVLAGMYLTDIPGNALVGLDSLESLSFYDNKLVKVPQLALQKVPNLKFLDLNKNPIHKIQE    211 - 280
GDFKNMLRLKELGINNMGELVSVDRYALDNLPELTKLEATNNPKLSYIHRLAFRSVPALESLMLNNNALN    281 - 350
AIYQKTVESLPNLREISIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMPPEYKGHQVKEVLIQDSSE    351 - 420
QCLPMISHDSFPNRLNVDIGTTVFLDCRAMAEPEPEIYWVTPIGNKITVETLSDKYKLSSEGTLEISNIQ    421 - 490
IEDSGRYTCVAQNVQGADTRVATIKVNGTLLDGTQVLKIYVKQTESHSILVSWKVNSNVMTSNLKWSSAT    491 - 560
MKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSNIHQQTQKSCVNVTTKNAAFAVDISDQETST    561 - 630
ALAAVMGSMFAVISLASIAVYFAKRFKRKNYHHSLKKYMQKTSSIPLNELYPPLINLWEGDSEKDKDGSA    631 - 700
DTKPTQVDTSRSYYMW                                                          701 - 716
//

Text Mined References (15)

PMID Year Title
23874384 2013 Genetics of callous-unemotional behavior in children.
20678249 2010 Polymorphisms in leucine-rich repeat genes are associated with autism spectrum disorder susceptibility in populations of European ancestry.
18591937 2008 N-MYC promotes cell proliferation through a direct transactivation of neuronal leucine-rich repeat protein-1 (NLRR1) gene in neuroblastoma.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...