Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.99
PubTator Score 3.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.82109455962327E-28
posterior fossa group B ependymoma 1530 1.65322804044894E-8
astrocytoma 1493 1.64818903673734E-7
lung carcinoma 2844 2.2336418046977E-6
sonic hedgehog group medulloblastoma 1482 1.49454911705304E-5
pilocytic astrocytoma 3086 3.47120339464632E-4
pancreatic cancer 2300 6.58360387220944E-4
glioblastoma 5572 8.27410523001832E-4
Breast cancer 3099 0.00121423364383259
oligodendroglioma 2849 0.00895227431756639
ovarian cancer 8492 0.0113214446239414
medulloblastoma, large-cell 6234 0.0149477417705186
ductal carcinoma in situ 1745 0.048109240547896
Disease Target Count Z-score Confidence
3p- syndrome 21 3.836 1.9
Newcastle disease 13 3.044 1.5

Expression

  Differential Expression (13)

Disease log2 FC p
posterior fossa group B ependymoma 2.000 0.000
oligodendroglioma 2.800 0.009
astrocytoma 1.400 0.000
glioblastoma 1.200 0.001
sonic hedgehog group medulloblastoma 2.000 0.000
medulloblastoma, large-cell 1.700 0.015
pancreatic cancer 1.600 0.001
pilocytic astrocytoma 1.400 0.000
lung carcinoma -1.300 0.000
Breast cancer -1.700 0.001
ductal carcinoma in situ 1.800 0.048
ovarian cancer 1.300 0.011
psoriasis -1.100 0.000

Synonym

Accession Q6UXK5 Q3LID5 Q8IYV5 Q9H8V1 Q9P231
Symbols NLRR-1
FIGLER3

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Xenopus OMA Inparanoid

 CSPA Cell Line (4)

Pathway (1)

Gene RIF (2)

PMID Text
20678249 Observational study of gene-disease association. (HuGE Navigator)
18591937 N-MYC promotes cell proliferation through a direct transactivation of neuronal leucine-rich repeat protein-1 (NLRR1) gene in neuroblastoma.

AA Sequence

MARMSFVIAACQLVLGLLMTSLTESSIQNSECPQLCVCEIRPWFTPQSTYREATTVDCNDLRLTRIPSNL      1 - 70
SSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNIKEVGLANLTQLTTLHLEENQITEMTDYCLQ     71 - 140
DLSNLQELYINHNQISTISAHAFAGLKNLLRLHLNSNKLKVIDSRWFDSTPNLEILMIGENPVIGILDMN    141 - 210
FKPLANLRSLVLAGMYLTDIPGNALVGLDSLESLSFYDNKLVKVPQLALQKVPNLKFLDLNKNPIHKIQE    211 - 280
GDFKNMLRLKELGINNMGELVSVDRYALDNLPELTKLEATNNPKLSYIHRLAFRSVPALESLMLNNNALN    281 - 350
AIYQKTVESLPNLREISIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMPPEYKGHQVKEVLIQDSSE    351 - 420
QCLPMISHDSFPNRLNVDIGTTVFLDCRAMAEPEPEIYWVTPIGNKITVETLSDKYKLSSEGTLEISNIQ    421 - 490
IEDSGRYTCVAQNVQGADTRVATIKVNGTLLDGTQVLKIYVKQTESHSILVSWKVNSNVMTSNLKWSSAT    491 - 560
MKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSNIHQQTQKSCVNVTTKNAAFAVDISDQETST    561 - 630
ALAAVMGSMFAVISLASIAVYFAKRFKRKNYHHSLKKYMQKTSSIPLNELYPPLINLWEGDSEKDKDGSA    631 - 700
DTKPTQVDTSRSYYMW                                                          701 - 716
//

Text Mined References (15)

PMID Year Title
23874384 2013 Genetics of callous-unemotional behavior in children.
20678249 2010 Polymorphisms in leucine-rich repeat genes are associated with autism spectrum disorder susceptibility in populations of European ancestry.
18591937 2008 N-MYC promotes cell proliferation through a direct transactivation of neuronal leucine-rich repeat protein-1 (NLRR1) gene in neuroblastoma.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...