Property Summary

NCBI Gene PubMed Count 15
PubMed Score 9.54
PubTator Score 3.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.400 1.6e-07
Astrocytoma, Pilocytic 1.500 3.2e-04
Breast cancer -1.700 1.2e-03
ductal carcinoma in situ 1.800 4.8e-02
ependymoma 1.900 1.8e-02
glioblastoma 1.200 8.3e-04
group 3 medulloblastoma 1.400 1.7e-02
lung carcinoma -1.300 2.2e-06
medulloblastoma, large-cell 1.700 1.5e-02
oligodendroglioma 2.800 9.0e-03
ovarian cancer 1.300 1.1e-02
pancreatic cancer 1.600 6.6e-04
psoriasis -1.100 2.8e-28

Gene RIF (2)

AA Sequence

MARMSFVIAACQLVLGLLMTSLTESSIQNSECPQLCVCEIRPWFTPQSTYREATTVDCNDLRLTRIPSNL      1 - 70
SSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNIKEVGLANLTQLTTLHLEENQITEMTDYCLQ     71 - 140
DLSNLQELYINHNQISTISAHAFAGLKNLLRLHLNSNKLKVIDSRWFDSTPNLEILMIGENPVIGILDMN    141 - 210
FKPLANLRSLVLAGMYLTDIPGNALVGLDSLESLSFYDNKLVKVPQLALQKVPNLKFLDLNKNPIHKIQE    211 - 280
GDFKNMLRLKELGINNMGELVSVDRYALDNLPELTKLEATNNPKLSYIHRLAFRSVPALESLMLNNNALN    281 - 350
AIYQKTVESLPNLREISIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMPPEYKGHQVKEVLIQDSSE    351 - 420
QCLPMISHDSFPNRLNVDIGTTVFLDCRAMAEPEPEIYWVTPIGNKITVETLSDKYKLSSEGTLEISNIQ    421 - 490
IEDSGRYTCVAQNVQGADTRVATIKVNGTLLDGTQVLKIYVKQTESHSILVSWKVNSNVMTSNLKWSSAT    491 - 560
MKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSNIHQQTQKSCVNVTTKNAAFAVDISDQETST    561 - 630
ALAAVMGSMFAVISLASIAVYFAKRFKRKNYHHSLKKYMQKTSSIPLNELYPPLINLWEGDSEKDKDGSA    631 - 700
DTKPTQVDTSRSYYMW                                                          701 - 716
//

Text Mined References (15)

PMID Year Title