Property Summary

NCBI Gene PubMed Count 13
Grant Count 6
R01 Count 4
Funding $217,845.37
PubMed Score 28.59
PubTator Score 26.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
23689482 The expression of nephronectin was sufficient to discriminate DN from other kidney diseases with mesangial matrix expansion and nodular lesions.
22172726 Nephronectin is associated with the development of diabetic glomerulosclerosis.
20332099 Observational study of gene-disease association. (HuGE Navigator)
20010835 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19844573 MicroRNA miR-378 regulates nephronectin expression modulating osteoblast differentiation by targeting GalNT-7

AA Sequence

MDFLLALVLVSSLYLQAAAEFDGRWPRQIVSSIGLCRYGGRIDCCWGWARQSWGQCQPVCQPRCKHGECI      1 - 70
GPNKCKCHPGYAGKTCNQDLNECGLKPRPCKHRCMNTYGSYKCYCLNGYMLMPDGSCSSALTCSMANCQY     71 - 140
GCDVVKGQIRCQCPSPGLQLAPDGRTCVDVDECATGRASCPRFRQCVNTFGSYICKCHKGFDLMYIGGKY    141 - 210
QCHDIDECSLGQYQCSSFARCYNIRGSYKCKCKEGYQGDGLTCVYIPKVMIEPSGPIHVPKGNGTILKGD    211 - 280
TGNNNWIPDVGSTWWPPKTPYIPPIITNRPTSKPTTRPTPKPTPIPTPPPPPPLPTELRTPLPPTTPERP    281 - 350
TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFEIERGVSADDEAKDDPGVLVH    351 - 420
SCNFDHGLCGWIREKDNDLHWEPIRDPAGGQYLTVSAAKAPGGKAARLVLPLGRLMHSGDLCLSFRHKVT    421 - 490
GLHSGTLQVFVRKHGAHGAALWGRNGGHGWRQTQITLRGADIKSVVFKGEKRRGHTGEIGLDDVSLKKGH    491 - 560
CSEER                                                                     561 - 565
//

Text Mined References (15)

PMID Year Title
23689482 2012 Nephronectin expression in glomeruli of renal biopsy specimens from various kidney diseases: nephronectin is expressed in the mesangial matrix expansion of diabetic nephropathy.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
22172726 2012 Proteome analysis of laser microdissected glomeruli from formalin-fixed paraffin-embedded kidneys of autopsies of diabetic patients: nephronectin is associated with the development of diabetic glomerulosclerosis.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
20010835 2010 Meta-analyses of genome-wide association studies identify multiple loci associated with pulmonary function.
19844573 2009 MicroRNA miR-378 regulates nephronectin expression modulating osteoblast differentiation by targeting GalNT-7.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15754038 2005 Identification and characterization of a novel human nephronectin gene in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...