Property Summary

NCBI Gene PubMed Count 11
PubMed Score 322.73
PubTator Score 411.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Atopic dermatitis -1.200 6.8e-04
Breast cancer -1.900 3.3e-02
breast carcinoma -1.400 2.9e-04
ductal carcinoma in situ -2.200 5.5e-05
fibroadenoma -1.300 2.8e-02
invasive ductal carcinoma -1.008 1.2e-02
psoriasis -1.200 5.1e-06

Gene RIF (1)

AA Sequence

MRTVVLTMKASVIEMFLVLLVTGVHSNKETAKKIKRPKFTVPQINCDVKAGKIIDPEFIVKCPAGCQDPK      1 - 70
YHVYGTDVYASYSSVCGAAVHSGVLDNSGGKILVRKVAGQSGYKGSYSNGVQSLSLPRWRESFIVLESKP     71 - 140
KKGVTYPSALTYSSSKSPAAQAGETTKAYQRPPIPGTTAQPVTLMQLLAVTVAVATPTTLPRPSPSAAST    141 - 210
TSIPRPQSVGHRSQEMDLWSTATYTSSQNRPRADPGIQRQDPSGAAFQKPVGADVSLGLVPKEELSTQSL    211 - 280
EPVSLGDPNCKIDLSFLIDGSTSIGKRRFRIQKQLLADVAQALDIGPAGPLMGVVQYGDNPATHFNLKTH    281 - 350
TNSRDLKTAIEKITQRGGLSNVGRAISFVTKNFFSKANGNRSGAPNVVVVMVDGWPTDKVEEASRLARES    351 - 420
GINIFFITIEGAAENEKQYVVEPNFANKAVCRTNGFYSLHVQSWFGLHKTLQPLVKRVCDTDRLACSKTC    421 - 490
LNSADIGFVIDGSSSVGTGNFRTVLQFVTNLTKEFEISDTDTRIGAVQYTYEQRLEFGFDKYSSKPDILN    491 - 560
AIKRVGYWSGGTSTGAAINFALEQLFKKSKPNKRKLMILITDGRSYDDVRIPAMAAHLKGVITYAIGVAW    561 - 630
AAQEELEVIATHPARDHSFFVDEFDNLHQYVPRIIQNICTEFNSQPRN                          631 - 678
//

Text Mined References (12)

PMID Year Title