Property Summary

NCBI Gene PubMed Count 21
PubMed Score 20.32
PubTator Score 16.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
aldosterone-producing adenoma -1.621 9.0e-03
Atopic dermatitis -1.500 1.3e-03
breast carcinoma -1.200 3.5e-04
ductal carcinoma in situ -1.300 1.1e-03
fibroadenoma -1.500 1.0e-02
invasive ductal carcinoma -1.500 3.8e-04
lung adenocarcinoma -1.800 4.1e-18
lung carcinoma -2.000 3.2e-16
non-small cell lung cancer -2.485 2.3e-23
osteosarcoma -1.929 5.9e-04
ovarian cancer -1.100 2.5e-07
sonic hedgehog group medulloblastoma -1.100 2.5e-03

Gene RIF (13)

AA Sequence

MVPPPPSRGGAARGQLGRSLGPLLLLLALGHTWTYREEPEDGDREICSESKIATTKYPCLKSSGELTTCY      1 - 70
RKKCCKGYKFVLGQCIPEDYDVCAEAPCEQQCTDNFGRVLCTCYPGYRYDRERHRKREKPYCLDIDECAS     71 - 140
SNGTLCAHICINTLGSYRCECREGYIREDDGKTCTRGDKYPNDTGHEKSENMVKAGTCCATCKEFYQMKQ    141 - 210
TVLQLKQKIALLPNNAADLGKYITGDKVLASNTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPG    211 - 280
PRGSMGPMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDIT    281 - 350
ELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP                  351 - 406
//

Text Mined References (24)

PMID Year Title