Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.01
PubTator Score 5.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 1.408 7.8e-03
astrocytoma 1.200 1.8e-02
colon cancer -1.300 4.4e-02
gastric carcinoma -1.300 8.1e-03
glioblastoma 1.200 2.1e-02
interstitial cystitis 1.100 3.8e-03
ovarian cancer 2.500 7.4e-07
pancreatic ductal adenocarcinoma liver m... -1.344 8.3e-03
psoriasis 1.900 2.9e-05
ulcerative colitis 1.700 4.1e-10

Gene RIF (5)

AA Sequence

MRLPRRAALGLLPLLLLLPPAPEAAKKPTPCHRCRGLVDKFNQGMVDTAKKNFGGGNTAWEEKTLSKYES      1 - 70
SEIRLLEILEGLCESSDFECNQMLEAQEEHLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLAC     71 - 140
QGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLT    141 - 210
NRDCGECEVGWVLDEGACVDVDECAAEPPPCSAAQFCKNANGSYTCEECDSSCVGCTGEGPGNCKECISG    211 - 280
YAREHGQCADVDECSLAEKTCVRKNENCYNTPGSYVCVCPDGFEETEDACVPPAEAEATEGESPTQLPSR    281 - 350
EDL                                                                       351 - 353
//

Text Mined References (16)

PMID Year Title