Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.99
PubTator Score 5.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.900 0.000
astrocytoma 1.200 0.018
glioblastoma 1.200 0.021
pancreatic ductal adenocarcinoma liver m... -1.344 0.008
colon cancer -1.300 0.044
active Crohn's disease 1.408 0.008
interstitial cystitis 1.300 0.000
gastric carcinoma -1.300 0.008
ulcerative colitis 1.700 0.000
ovarian cancer 2.500 0.000

Gene RIF (5)

PMID Text
24687431 intravesicular acidification by V-ATPase regulates the secretion of CRELD2 without relying on the balance of intracellular calcium ions and the expression of endoplasmic reticulum chaperones such as GRP78 and protein disulfide isomerase.
24019898 results strongly suggest that Creld2 may be directly regulated by BMP9 and ER stress response may play an important role in regulating osteogenic differentiation
23956175 We demonstrate that Armet and Creld2 are genotype-specific ER stress response proteins with substrate specificities, and that aggregation of mutant matrilin-3 is a key disease trigger in MED that could be exploited as a potential therapeutic target
16919896 Mapping of CRELD2 by FISH shows that it maps to 22q13 rather than the GenBank reported locus of 22p13.
16238698 CRELD2 can act as a specific regulator of alpha4beta2 nAChR expression

AA Sequence

MRLPRRAALGLLPLLLLLPPAPEAAKKPTPCHRCRGLVDKFNQGMVDTAKKNFGGGNTAWEEKTLSKYES      1 - 70
SEIRLLEILEGLCESSDFECNQMLEAQEEHLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLAC     71 - 140
QGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLT    141 - 210
NRDCGECEVGWVLDEGACVDVDECAAEPPPCSAAQFCKNANGSYTCEECDSSCVGCTGEGPGNCKECISG    211 - 280
YAREHGQCADVDECSLAEKTCVRKNENCYNTPGSYVCVCPDGFEETEDACVPPAEAEATEGESPTQLPSR    281 - 350
EDL                                                                       351 - 353
//

Text Mined References (16)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24687431 2014 Characterization of V-ATPase inhibitor-induced secretion of cysteine-rich with EGF-like domains 2.
24019898 2013 Endoplasmic reticulum (ER) stress inducible factor cysteine-rich with EGF-like domains 2 (Creld2) is an important mediator of BMP9-regulated osteogenic differentiation of mesenchymal stem cells.
23956175 2013 Armet/Manf and Creld2 are components of a specialized ER stress response provoked by inappropriate formation of disulphide bonds: implications for genetic skeletal diseases.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
16919896 2006 CRELD2: gene mapping, alternate splicing, and comparative genomic identification of the promoter region.
16238698 2005 The cysteine-rich with EGF-like domains 2 (CRELD2) protein interacts with the large cytoplasmic domain of human neuronal nicotinic acetylcholine receptor alpha4 and beta2 subunits.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
More...