Property Summary

NCBI Gene PubMed Count 42
Grant Count 12
R01 Count 7
Funding $5,297,325.25
PubMed Score 49.86
PubTator Score 27.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma -1.300 0.003
non primary Sjogren syndrome sicca 1.300 0.014
ductal carcinoma in situ -1.300 0.002
invasive ductal carcinoma -1.200 0.018

Gene RIF (32)

PMID Text
27242389 Meta-analysis results from case control studies on betatrophin and type 2 diabetes (T2DM) revealed increased circulating levels of betatrophin in patients with T2DM.
27053679 An ANGPTL3-4-8 model was proposed to explain the variations of lipoprotein lipase (LPL) activity during the fed-fast cycle. Feeding induces ANGPTL8, activating the ANGPTL8-ANGPTL3 pathway, which inhibits LPL in cardiac and skeletal muscles to direct circulating triglycerides (TG) to white adipose tissue; the reverse is true during fasting, which suppresses ANGPTL8 but induces ANGPTL4, thereby directing TG to muscles.
26850725 ANGPTL8 is increased in subjects with MetS and it was significantly associated with HsCRP levels in different subgroups.
26822414 Disruption of ANGPTL8 function in humans does not seem to have a large effect on measures of glucose tolerance.
26784326 Results demonstrate that ANGPTL8 was increased in obese patients.
26739836 Betatrophin is significantly increased in T2DM patients with different stages of albuminuria. Betatrophin may be a novel endocrine regulator involved in DN development.
26739706 ANGPTL8 levels were associated with baseline and future changes in triglyceride levels in Korean children.
26697500 Based on the findings of our meta-analysis, circulating betatrophin level of T2DM patients is higher than that of nondiabetic adults in the nonobese population, but not in the obese population.
26649318 In patients with diabetes mellitus type 2, betatrophin levels did not correlate with beta-cell function-related variables or insulin resistance-related variables
26569053 ANGPTL8 is a stress-response protein that down-regulates expression of ATGL.
More...

AA Sequence

MPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLY      1 - 70
GRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSA     71 - 140
WLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA                141 - 198
//

Text Mined References (47)

PMID Year Title
27242389 2016 The Relationship between Betatrophin Levels in Blood and T2DM: A Systematic Review and Meta-Analysis.
27117576 2016 The Arg59Trp variant in ANGPTL8 (betatrophin) is associated with total and HDL-cholesterol in American Indians and Mexican Americans and differentially affects cleavage of ANGPTL3.
27053679 2016 The ANGPTL3-4-8 model, a molecular mechanism for triglyceride trafficking.
26850725 2016 Circulating angiopoietin-like protein 8 (betatrophin) association with HsCRP and metabolic syndrome.
26822414 2016 A null mutation in ANGPTL8 does not associate with either plasma glucose or type 2 diabetes in humans.
26784326 2016 Circulating ANGPTL8/Betatrophin Is Increased in Obesity and Reduced after Exercise Training.
26739836 2016 Higher serum betatrophin level in type 2 diabetes subjects is associated with urinary albumin excretion and renal function.
26739706 2016 Circulating angiopoietin-like protein 8 (ANGPTL8) and ANGPTL3 concentrations in relation to anthropometric and metabolic profiles in Korean children: a prospective cohort study.
26697500 2016 Circulating Betatrophin in Patients with Type 2 Diabetes: A Meta-Analysis.
26649318 2016 Circulating Levels of Betatrophin and Irisin Are Not Associated with Pancreatic ?-Cell Function in Previously Diagnosed Type 2 Diabetes Mellitus Patients.
More...