Property Summary

NCBI Gene PubMed Count 65
PubMed Score 141.19
PubTator Score 27.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma -1.300 2.8e-03
ductal carcinoma in situ -1.300 1.6e-03
invasive ductal carcinoma -1.200 1.8e-02
non primary Sjogren syndrome sicca 1.300 1.4e-02

Synonym

Accession Q6UXH0 Q9NQZ1
Symbols RIFL
TD26
PRO1185
PVPA599
C19orf80

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (56)

AA Sequence

MPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLY      1 - 70
GRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSA     71 - 140
WLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA                141 - 198
//

Text Mined References (71)

PMID Year Title