Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.69
PubTator Score 2.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active ulcerative colitis 1.220 3.8e-02
adult high grade glioma -1.700 3.5e-05
atypical teratoid / rhabdoid tumor -1.500 1.1e-04
Breast cancer -2.000 4.7e-02
breast carcinoma -1.900 2.9e-04
ductal carcinoma in situ -3.200 5.6e-05
Endometriosis -2.452 9.5e-03
fibroadenoma -2.400 5.3e-03
glioblastoma -1.700 1.0e-03
group 3 medulloblastoma 1.400 1.1e-02
intraductal papillary-mucinous carcinoma... 1.200 3.6e-02
intraductal papillary-mucinous neoplasm ... 1.200 4.6e-02
invasive ductal carcinoma -4.100 3.1e-05
lung adenocarcinoma -1.600 9.0e-16
lung carcinoma -1.600 5.0e-10
medulloblastoma, large-cell -1.500 5.2e-04
non-small cell lung cancer -3.521 2.6e-30
osteosarcoma 1.937 4.5e-04
psoriasis -1.500 2.7e-08

AA Sequence

MVDLSVSPDSLKPVSLTSSLVFLMHLLLLQPGEPSSEVKVLGPEYPILALVGEEVEFPCHLWPQLDAQQM      1 - 70
EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQLHSIIPSDKGTYGCRFHSDNF     71 - 140
SGEALWELEVAGLGSDPHLSLEGFKEGGIQLRLRSSGWYPKPKVQWRDHQGQCLPPEFEAIVWDAQDLFS    141 - 210
LETSVVVRAGALSNVSVSIQNLLLSQKKELVVQIADVFVPGASAWKSAFVATLPLLLVLAALALGVLRKQ    211 - 280
RRSREKLRKQAEKRQEKLTAELEKLQTELDWRRAEGQAEWRAAQKYAVDVTLDPASAHPSLEVSEDGKSV    281 - 350
SSRGAPPGPAPGHPQRFSEQTCALSLERFSAGRHYWEVHVGRRSRWFLGACLAAVPRAGPARLSPAAGYW    351 - 420
VLGLWNGCEYFVLAPHRVALTLRVPPRRLGVFLDYEAGELSFFNVSDGSHIFTFHDTFSGALCAYFRPRA    421 - 490
HDGGEHPDPLTICPLPVRGTGVPEENDSDTWLQPYEPADPALDWW                             491 - 535
//

Text Mined References (5)

PMID Year Title