Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.26
PubTator Score 5.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.48290928144133E-19
psoriasis 6685 4.74255931775414E-6
osteosarcoma 7933 1.1968410699949E-5
medulloblastoma, large-cell 6234 1.88365845831726E-5
invasive ductal carcinoma 2950 2.943160320048E-5
breast carcinoma 1614 4.16486628048072E-5
ductal carcinoma in situ 1745 4.3605846453313E-5
fibroadenoma 557 0.0120502575225493
Breast cancer 3099 0.0215258560780546

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -5.110 0.000
medulloblastoma, large-cell 1.300 0.000
non-small cell lung cancer -2.042 0.000
breast carcinoma -1.900 0.000
fibroadenoma -2.000 0.012
Breast cancer -6.800 0.022
invasive ductal carcinoma -5.100 0.000
psoriasis -1.400 0.000
ductal carcinoma in situ -4.000 0.000

Synonym

Accession Q6UXG3 B4DNY5 F5H7P9 F8W9M3 Q8IX38 Q8IX39 Q8TA95 CLM-9
Symbols CLM9
CLM-9
TREM4
TREM-4
NEPMUCIN

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
25314291 Blood pressure, measured with a sensitive method, in a small sample of CD300LG rs72836561 CT-carriers was higher than in CC-carriers.

AA Sequence

MRLLVLLWGCLLLPGYEALEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEE      1 - 70
GQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPGPCCPPSPSPTFQP     71 - 140
LATTRLQPKAKAQQTQPPGLTSPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPP    141 - 210
AGSSRPPMQLDSTSAEDTSPALSSGSSKPRVSIPMVRILAPVLVLLSLLSAAGLIAFCSHLLLWRKEAQQ    211 - 280
ATETQRNEKFCLSRLTAEEKEAPSQAPEGDVISMPPLHTSEEELGFSKFVSA                      281 - 332
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25314291 2014 Blood pressure levels in male carriers of Arg82Cys in CD300LG.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19592130 2009 The CD300 molecules regulate monocyte and dendritic cell functions.
19359216 2009 The CD300 family of molecules are evolutionarily significant regulators of leukocyte functions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16876123 2006 CD300 antigen like family member G: A novel Ig receptor like protein exclusively expressed on capillary endothelium.
16754720 2006 Nepmucin, a novel HEV sialomucin, mediates L-selectin-dependent lymphocyte rolling and promotes lymphocyte adhesion under flow.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...