Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.33
PubTator Score 5.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer -6.800 2.2e-02
breast carcinoma -1.900 4.2e-05
ductal carcinoma in situ -4.000 4.4e-05
fibroadenoma -2.000 1.2e-02
invasive ductal carcinoma -1.064 3.9e-02
medulloblastoma, large-cell 1.300 1.9e-05
non-small cell lung cancer -2.042 1.5e-19
osteosarcoma -5.110 1.2e-05
psoriasis -1.400 4.7e-06

 GO Function (1)

Gene RIF (2)

AA Sequence

MRLLVLLWGCLLLPGYEALEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEE      1 - 70
GQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPGPCCPPSPSPTFQP     71 - 140
LATTRLQPKAKAQQTQPPGLTSPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPP    141 - 210
AGSSRPPMQLDSTSAEDTSPALSSGSSKPRVSIPMVRILAPVLVLLSLLSAAGLIAFCSHLLLWRKEAQQ    211 - 280
ATETQRNEKFCLSRLTAEEKEAPSQAPEGDVISMPPLHTSEEELGFSKFVSA                      281 - 332
//

Text Mined References (15)

PMID Year Title