Property Summary

NCBI Gene PubMed Count 14
Grant Count 10
Funding $656,125.26
PubMed Score 19.15
PubTator Score 9.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
astrocytic glioma -2.100 0.005
ependymoma -2.000 0.022
oligodendroglioma -1.900 0.013
psoriasis -3.000 0.000
glioblastoma -2.100 0.000
osteosarcoma -1.450 0.001
medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -2.000 0.004
primitive neuroectodermal tumor -1.600 0.008
primary pancreatic ductal adenocarcinoma -2.759 0.001
intraductal papillary-mucinous neoplasm ... -3.100 0.023
colon cancer -2.500 0.035
lung cancer -1.900 0.002
active Crohn's disease 1.124 0.006
active ulcerative colitis 1.002 0.023
pancreatic cancer -2.500 0.002
pediatric high grade glioma -1.400 0.000
non primary Sjogren syndrome sicca 1.200 0.012
Breast cancer -2.300 0.000
lung carcinoma 3.500 0.000
Pick disease -1.200 0.006
gastric carcinoma -1.700 0.039
ductal carcinoma in situ 3.100 0.007
invasive ductal carcinoma 3.000 0.044

 GO Function (1)

Gene RIF (5)

PMID Text
26045166 A tumor suppressive role of KIAA1324 via inhibition of GRP78 oncoprotein activities in gastric cancer
21102415 High expression of ERalpha and the estrogen-induced gene EIG121 predicts shorter overall survival in patients with high-grade serous ovarian carcinoma.
21072319 EIG121 may protect cells from cell death by upregulating the autophagy pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16322283 Down-regulation of KIAA1324 protein is associated with endometrial cancer

AA Sequence

MAEPGHSHHLSARVRGRTERRIPRLWRLLLWAGTAFQVTQGTGPELHACKESEYHYEYTACDSTGSRWRV      1 - 70
AVPHTPGLCTSLPDPIKGTECSFSCNAGEFLDMKDQSCKPCAEGRYSLGTGIRFDEWDELPHGFASLSAN     71 - 140
MELDDSAAESTGNCTSSKWVPRGDYIASNTDECTATLMYAVNLKQSGTVNFEYYYPDSSIIFEFFVQNDQ    141 - 210
CQPNADDSRWMKTTEKGWEFHSVELNRGNNVLYWRTTAFSVWTKVPKPVLVRNIAITGVAYTSECFPCKP    211 - 280
GTYADKQGSSFCKLCPANSYSNKGETSCHQCDPDKYSEKGSSSCNVRPACTDKDYFYTHTACDANGETQL    281 - 350
MYKWAKPKICSEDLEGAVKLPASGVKTHCPPCNPGFFKTNNSTCQPCPYGSYSNGSDCTRCPAGTEPAVG    351 - 420
FEYKWWNTLPTNMETTVLSGINFEYKGMTGWEVAGDHIYTAAGASDNDFMILTLVVPGFRPPQSVMADTE    421 - 490
NKEVARITFVFETLCSVNCELYFMVGVNSRTNTPVETWKGSKGKQSYTYIIEENTTTSFTWAFQRTTFHE    491 - 560
ASRKYTNDVAKIYSINVTNVMNGVASYCRPCALEASDVGSSCTSCPAGYYIDRDSGTCHSCPTNTILKAH    561 - 630
QPYGVQACVPCGPGTKNNKIHSLCYNDCTFSRNTPTRTFNYNFSALANTVTLAGGPSFTSKGLKYFHHFT    631 - 700
LSLCGNQGRKMSVCTDNVTDLRIPEGESGFSKSITAYVCQAVIIPPEVTGYKAGVSSQPVSLADRLIGVT    701 - 770
TDMTLDGITSPAELFHLESLGIPDVIFFYRSNDVTQSCSSGRSTTIRVRCSPQKTVPGSLLLPGTCSDGT    771 - 840
CDGCNFHFLWESAAACPLCSVADYHAIVSSCVAGIQKTTYVWREPKLCSGGISLPEQRVTICKTIDFWLK    841 - 910
VGISAGTCTAILLTVLTCYFWKKNQKLEYKYSKLVMNATLKDCDLPAADSCAIMEGEDVEDDLIFTSKKS    911 - 980
LFGKIKSFTSKRTPDGFDSVPLKTSSGGLDMDL                                         981 - 1013
//

Text Mined References (17)

PMID Year Title
26045166 2015 KIAA1324 Suppresses Gastric Cancer Progression by Inhibiting the Oncoprotein GRP78.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21102415 2011 Molecular clustering based on ER? and EIG121 predicts survival in high-grade serous carcinoma of the ovary/peritoneum.
21072319 2010 The novel estrogen-induced gene EIG121 regulates autophagy and promotes cell survival under stress.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...