Property Summary

NCBI Gene PubMed Count 15
PubMed Score 19.78
PubTator Score 9.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 1.124 6.3e-03
active ulcerative colitis 1.002 2.3e-02
adult high grade glioma -1.300 2.2e-02
astrocytic glioma -2.100 5.3e-03
atypical teratoid / rhabdoid tumor -1.900 3.0e-05
Breast cancer -1.100 3.9e-03
colon cancer -2.100 1.4e-02
ductal carcinoma in situ 2.000 3.2e-02
ependymoma -2.000 2.2e-02
gastric carcinoma -1.700 3.9e-02
glioblastoma -2.100 2.2e-05
group 4 medulloblastoma -1.200 3.3e-02
intraductal papillary-mucinous neoplasm ... -2.300 2.5e-02
invasive ductal carcinoma 3.000 4.4e-02
lung cancer -1.900 1.5e-03
lung carcinoma 3.500 4.0e-16
medulloblastoma, large-cell -2.000 3.6e-03
non primary Sjogren syndrome sicca 1.200 1.2e-02
oligodendroglioma -1.900 1.3e-02
osteosarcoma -1.450 1.0e-03
pancreatic cancer -1.700 5.2e-04
Pick disease -1.200 5.7e-03
primary pancreatic ductal adenocarcinoma -2.759 8.4e-04
primitive neuroectodermal tumor -1.600 7.9e-03
psoriasis -1.100 1.5e-06

 GO Function (1)

Gene RIF (6)

AA Sequence

MAEPGHSHHLSARVRGRTERRIPRLWRLLLWAGTAFQVTQGTGPELHACKESEYHYEYTACDSTGSRWRV      1 - 70
AVPHTPGLCTSLPDPIKGTECSFSCNAGEFLDMKDQSCKPCAEGRYSLGTGIRFDEWDELPHGFASLSAN     71 - 140
MELDDSAAESTGNCTSSKWVPRGDYIASNTDECTATLMYAVNLKQSGTVNFEYYYPDSSIIFEFFVQNDQ    141 - 210
CQPNADDSRWMKTTEKGWEFHSVELNRGNNVLYWRTTAFSVWTKVPKPVLVRNIAITGVAYTSECFPCKP    211 - 280
GTYADKQGSSFCKLCPANSYSNKGETSCHQCDPDKYSEKGSSSCNVRPACTDKDYFYTHTACDANGETQL    281 - 350
MYKWAKPKICSEDLEGAVKLPASGVKTHCPPCNPGFFKTNNSTCQPCPYGSYSNGSDCTRCPAGTEPAVG    351 - 420
FEYKWWNTLPTNMETTVLSGINFEYKGMTGWEVAGDHIYTAAGASDNDFMILTLVVPGFRPPQSVMADTE    421 - 490
NKEVARITFVFETLCSVNCELYFMVGVNSRTNTPVETWKGSKGKQSYTYIIEENTTTSFTWAFQRTTFHE    491 - 560
ASRKYTNDVAKIYSINVTNVMNGVASYCRPCALEASDVGSSCTSCPAGYYIDRDSGTCHSCPTNTILKAH    561 - 630
QPYGVQACVPCGPGTKNNKIHSLCYNDCTFSRNTPTRTFNYNFSALANTVTLAGGPSFTSKGLKYFHHFT    631 - 700
LSLCGNQGRKMSVCTDNVTDLRIPEGESGFSKSITAYVCQAVIIPPEVTGYKAGVSSQPVSLADRLIGVT    701 - 770
TDMTLDGITSPAELFHLESLGIPDVIFFYRSNDVTQSCSSGRSTTIRVRCSPQKTVPGSLLLPGTCSDGT    771 - 840
CDGCNFHFLWESAAACPLCSVADYHAIVSSCVAGIQKTTYVWREPKLCSGGISLPEQRVTICKTIDFWLK    841 - 910
VGISAGTCTAILLTVLTCYFWKKNQKLEYKYSKLVMNATLKDCDLPAADSCAIMEGEDVEDDLIFTSKKS    911 - 980
LFGKIKSFTSKRTPDGFDSVPLKTSSGGLDMDL                                         981 - 1013
//

Text Mined References (18)

PMID Year Title