Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.31
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6UXF7 B4DF90
Symbols MRCL2

Gene

PANTHER Protein Class (1)

AA Sequence

MLHPETSPGRGHLLAVLLALLGTTWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRSWVQPPAADMR      1 - 70
RLDWSDSLAQLAQARAALCGIPTPSLASGLWRTLQVGWNMQLLPAGLASFVEVVSLWFAEGQRYSHAAGE     71 - 140
CARNATCTHYTQLVWATSSQLGCGRHLCSAGQTAIEAFVCAYSPGGNWEVNGKTIIPYKKGAWCSLCTAS    141 - 210
VSGCFKAWDHAGGLCEVPRNPCRMSCQNHGRLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSC    211 - 280
VCDIGYGGAQCATKVHFPFHTCDLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDILAFYL    281 - 350
GRLETTNEVIDSDFETRNFWIGLTYKTAKDSFRWATGEHQAFTSFAFGQPDNHGLVWLSAAMGFGNCVEL    351 - 420
QASAAFNWNDQRCKTRNRYICQFAQEHISRWGPGS                                       421 - 455
//

Text Mined References (7)

PMID Year Title
26170455 2015 Human CLEC18 Gene Cluster Contains C-type Lectins with Differential Glycan-binding Specificity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16336259 2005 The C-type lectin-like domain superfamily.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.