Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.31
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6UXF7 B4DF90
Symbols MRCL2

Gene

PANTHER Protein Class (1)

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Platypus OMA Inparanoid

AA Sequence

MLHPETSPGRGHLLAVLLALLGTTWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRSWVQPPAADMR      1 - 70
RLDWSDSLAQLAQARAALCGIPTPSLASGLWRTLQVGWNMQLLPAGLASFVEVVSLWFAEGQRYSHAAGE     71 - 140
CARNATCTHYTQLVWATSSQLGCGRHLCSAGQTAIEAFVCAYSPGGNWEVNGKTIIPYKKGAWCSLCTAS    141 - 210
VSGCFKAWDHAGGLCEVPRNPCRMSCQNHGRLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSC    211 - 280
VCDIGYGGAQCATKVHFPFHTCDLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDILAFYL    281 - 350
GRLETTNEVIDSDFETRNFWIGLTYKTAKDSFRWATGEHQAFTSFAFGQPDNHGLVWLSAAMGFGNCVEL    351 - 420
QASAAFNWNDQRCKTRNRYICQFAQEHISRWGPGS                                       421 - 455
//

Text Mined References (7)

PMID Year Title
26170455 2015 Human CLEC18 Gene Cluster Contains C-type Lectins with Differential Glycan-binding Specificity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16336259 2005 The C-type lectin-like domain superfamily.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.