Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.31
PubTator Score 0.33

Knowledge Summary


No data available


AA Sequence

QASAAFNWNDQRCKTRNRYICQFAQEHISRWGPGS                                       421 - 455

Text Mined References (7)

PMID Year Title