Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.71
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 6.28001145933972E-76
non-small cell lung cancer 2798 2.02698988911878E-16
posterior fossa group B ependymoma 1530 5.21788828178548E-10
medulloblastoma, large-cell 6234 1.50527077747636E-5
group 4 medulloblastoma 1875 4.37089500702548E-5
pituitary cancer 1972 5.604290802942E-5
lung carcinoma 2844 1.13249632039519E-4
Breast cancer 3099 0.00109250626692265
atypical teratoid / rhabdoid tumor 4369 0.00149876476114236
osteosarcoma 7933 0.00220078797215653
adrenocortical carcinoma 1427 0.00387189952698061
aldosterone-producing adenoma 664 0.0227199157288534
glioblastoma 5572 0.0398833566608084
subependymal giant cell astrocytoma 2287 0.047338281070306
Disease Target Count Z-score Confidence
Allergic rhinitis 92 0.0 1.0
substance-related disorder 105 0.0 1.0

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma -2.520 0.002
atypical teratoid / rhabdoid tumor -1.800 0.001
glioblastoma -1.400 0.040
medulloblastoma, large-cell -2.100 0.000
adrenocortical carcinoma -1.653 0.004
non-small cell lung cancer -1.503 0.000
group 4 medulloblastoma 1.600 0.000
posterior fossa group B ependymoma 1.300 0.000
aldosterone-producing adenoma -1.217 0.023
subependymal giant cell astrocytoma -2.233 0.047
lung carcinoma 1.300 0.000
Breast cancer -1.100 0.001
pituitary cancer 2.100 0.000
psoriasis -1.600 0.000

Synonym

Accession Q6UXF1 D3DNC9 Q9BQH1 Q9BW81 Q9C0H3
Symbols CT124

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MKRSLQALYCQLLSFLLILALTEALAFAIQEPSPRESLQVLPSGTPPGTMVTAPHSSTRHTSVVMLTPNP      1 - 70
DGPPSQAAAPMATPTPRAEGHPPTHTISTIAATVTAPHSESSLSTGPAPAAMATTSSKPEGRPRGQAAPT     71 - 140
ILLTKPPGATSRPTTAPPRTTTRRPPRPPGSSRKGAGNSSRPVPPAPGGHSRSKEGQRGRNPSSTPLGQK    141 - 210
RPLGKIFQIYKGNFTGSVEPEPSTLTPRTPLWGYSSSPQPQTVAATTVPSNTSWAPTTTSLGPAKDKPGL    211 - 280
RRAAQGGGSTFTSQGGTPDATAASGAPVSPQAAPVPSQRPHHGDPQDGPSHSDSWLTVTPGTSRPLSTSS    281 - 350
GVFTAATGPTPAAFDTSVSAPSQGIPQGASTTPQAPTHPSRVSESTISGAKEETVATLTMTDRVPSPLST    351 - 420
VVSTATGNFLNRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPISSCSVLLTVC    421 - 490
CMKRKKKTANPENNLSYWNNTITMDYFNRHAVELPREIQSLETSEDQLSEPRSPANGDYRDTGMVLVNPF    491 - 560
CQETLFVGNDQVSEI                                                           561 - 575
//

Text Mined References (12)

PMID Year Title
22036096 2011 A genome-wide meta-analysis of genetic variants associated with allergic rhinitis and grass sensitization and their interaction with birth order.
21529783 2011 A quantitative-trait genome-wide association study of alcoholism risk in the community: findings and implications.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
More...