Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.71
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma -1.123 1.9e-02
aldosterone-producing adenoma -1.217 2.3e-02
atypical teratoid / rhabdoid tumor -1.800 1.5e-03
Breast cancer -1.100 1.1e-03
glioblastoma -1.400 4.0e-02
group 4 medulloblastoma 1.600 4.4e-05
lung carcinoma 1.300 1.1e-04
medulloblastoma, large-cell -2.100 1.5e-05
non-small cell lung cancer -1.503 2.0e-16
osteosarcoma -2.520 2.2e-03
pituitary cancer 2.100 5.6e-05
posterior fossa group B ependymoma 1.300 5.2e-10
psoriasis -1.600 6.3e-76
subependymal giant cell astrocytoma -2.233 4.7e-02

Gene RIF (2)

AA Sequence

MKRSLQALYCQLLSFLLILALTEALAFAIQEPSPRESLQVLPSGTPPGTMVTAPHSSTRHTSVVMLTPNP      1 - 70
DGPPSQAAAPMATPTPRAEGHPPTHTISTIAATVTAPHSESSLSTGPAPAAMATTSSKPEGRPRGQAAPT     71 - 140
ILLTKPPGATSRPTTAPPRTTTRRPPRPPGSSRKGAGNSSRPVPPAPGGHSRSKEGQRGRNPSSTPLGQK    141 - 210
RPLGKIFQIYKGNFTGSVEPEPSTLTPRTPLWGYSSSPQPQTVAATTVPSNTSWAPTTTSLGPAKDKPGL    211 - 280
RRAAQGGGSTFTSQGGTPDATAASGAPVSPQAAPVPSQRPHHGDPQDGPSHSDSWLTVTPGTSRPLSTSS    281 - 350
GVFTAATGPTPAAFDTSVSAPSQGIPQGASTTPQAPTHPSRVSESTISGAKEETVATLTMTDRVPSPLST    351 - 420
VVSTATGNFLNRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPISSCSVLLTVC    421 - 490
CMKRKKKTANPENNLSYWNNTITMDYFNRHAVELPREIQSLETSEDQLSEPRSPANGDYRDTGMVLVNPF    491 - 560
CQETLFVGNDQVSEI                                                           561 - 575
//

Text Mined References (12)

PMID Year Title