Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.71
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma -2.520 0.002
atypical teratoid / rhabdoid tumor -1.800 0.001
glioblastoma -1.400 0.040
medulloblastoma, large-cell -2.100 0.000
adrenocortical carcinoma -1.653 0.004
non-small cell lung cancer -1.503 0.000
group 4 medulloblastoma 1.600 0.000
posterior fossa group B ependymoma 1.300 0.000
aldosterone-producing adenoma -1.217 0.023
subependymal giant cell astrocytoma -2.233 0.047
lung carcinoma 1.300 0.000
Breast cancer -1.100 0.001
pituitary cancer 2.100 0.000
psoriasis -1.600 0.000

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MKRSLQALYCQLLSFLLILALTEALAFAIQEPSPRESLQVLPSGTPPGTMVTAPHSSTRHTSVVMLTPNP      1 - 70
DGPPSQAAAPMATPTPRAEGHPPTHTISTIAATVTAPHSESSLSTGPAPAAMATTSSKPEGRPRGQAAPT     71 - 140
ILLTKPPGATSRPTTAPPRTTTRRPPRPPGSSRKGAGNSSRPVPPAPGGHSRSKEGQRGRNPSSTPLGQK    141 - 210
RPLGKIFQIYKGNFTGSVEPEPSTLTPRTPLWGYSSSPQPQTVAATTVPSNTSWAPTTTSLGPAKDKPGL    211 - 280
RRAAQGGGSTFTSQGGTPDATAASGAPVSPQAAPVPSQRPHHGDPQDGPSHSDSWLTVTPGTSRPLSTSS    281 - 350
GVFTAATGPTPAAFDTSVSAPSQGIPQGASTTPQAPTHPSRVSESTISGAKEETVATLTMTDRVPSPLST    351 - 420
VVSTATGNFLNRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPISSCSVLLTVC    421 - 490
CMKRKKKTANPENNLSYWNNTITMDYFNRHAVELPREIQSLETSEDQLSEPRSPANGDYRDTGMVLVNPF    491 - 560
CQETLFVGNDQVSEI                                                           561 - 575
//

Text Mined References (12)

PMID Year Title
22036096 2011 A genome-wide meta-analysis of genetic variants associated with allergic rhinitis and grass sensitization and their interaction with birth order.
21529783 2011 A quantitative-trait genome-wide association study of alcoholism risk in the community: findings and implications.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
More...