Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.48
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 3.4e-04
ulcerative colitis 1819 2.2e-03
colon cancer 1478 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Pulmonary sarcoidosis 2 3.46 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer -1.600 2.6e-02
osteosarcoma -1.105 3.4e-04
ulcerative colitis -1.100 2.2e-03

AA Sequence

MAFVLILVLSFYELVSGQWQVTGPGKFVQALVGEDAVFSCSLFPETSAEAMEVRFFRNQFHAVVHLYRDG      1 - 70
EDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQIYDEEATWELRVAALGSLPLI     71 - 140
SIVGYVDGGIQLLCLSSGWFPQPTAKWKGPQGQDLSSDSRANADGYSLYDVEISIIVQENAGSILCSIHL    141 - 210
AEQSHEVESKVLIGETFFQPSPWRLASILLGLLCGALCGVVMGMIIVFFKSKGKIQAELDWRRKHGQAEL    211 - 280
RDARKHAVEVTLDPETAHPKLCVSDLKTVTHRKAPQEVPHSEKRFTRKSVVASQGFQAGKHYWEVDVGQN    281 - 350
VGWYVGVCRDDVDRGKNNVTLSPNNGYWVLRLTTEHLYFTFNPHFISLPPSTPPTRVGVFLDYEGGTISF    351 - 420
FNTNDQSLIYTLLTCQFEGLLRPYIQHAMYDEEKGTPIFICPVSWG                            421 - 466
//

Text Mined References (6)

PMID Year Title