Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.38
PubTator Score 5.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.355 0.012
Atopic dermatitis -1.600 0.000
breast carcinoma -1.500 0.003
posterior fossa group B ependymoma 1.600 0.000
lung adenocarcinoma -1.400 0.000
non-inflammatory breast cancer -1.900 0.000
ductal carcinoma in situ -1.500 0.006
invasive ductal carcinoma -1.400 0.030

Gene RIF (3)

PMID Text
22533972 PI16-positive Treg showed enhanced in vitro migration towards the inflammatory chemokines CCL17 and CCL20, suggesting they can migrate to sites of inflammation
17062675 a novel and independent prognostic markers following radical prostatectomy for prostate cancer.
15344909 A new blood protein PSP94-binding protein (PSPBP) is identified that binds prostate secretory protein of 94 amino acids (PSP94).

AA Sequence

MHGSCSFLMLLLPLLLLLVATTGPVGALTDEEKRLMVELHNLYRAQVSPTASDMLHMRWDEELAAFAKAY      1 - 70
ARQCVWGHNKERGRRGENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERI     71 - 140
GCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLCEPIGSPEDAQDLP    141 - 210
YLVTEAPSFRATEASDSRKMGTPSSLATGIPAFLVTEVSGSLATKALPAVETQAPTSLATKDPPSMATEA    211 - 280
PPCVTTEVPSILAAHSLPSLDEEPVTFPKSTHVPIPKSADKVTDKTKVPSRSPENSLDPKMSLTGARELL    281 - 350
PHAQEEAEAEAELPPSSEVLASVFPAQDKPGELQATLDHTGHTSSKSLPNFPNTSATANATGGRALALQS    351 - 420
SLPGAEGPDKPSVVSGLNSGPGHVWGPLLGLLLLPPLVLAGIF                               421 - 463
//

Text Mined References (14)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22533972 PI16 is expressed by a subset of human memory Treg with enhanced migration to CCL17 and CCL20.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
20237162 2010 Chemerin, a novel adipokine in the regulation of angiogenesis.
17062675 2006 Prognostic value of prostate secretory protein of 94 amino acids and its binding protein after radical prostatectomy.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15344909 2005 Identification, purification and characterization of a novel human blood protein with binding affinity for prostate secretory protein of 94 amino acids.
More...