Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.15
PubTator Score 19.08

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.874 1.9e-05
atypical teratoid / rhabdoid tumor -1.200 1.3e-07
glioblastoma -1.200 6.5e-06
primitive neuroectodermal tumor -1.300 5.0e-05
interstitial cystitis 1.500 9.8e-04
pilocytic astrocytoma -1.100 3.4e-06
sonic hedgehog group medulloblastoma -1.100 7.4e-04
psoriasis 1.100 6.5e-10

Gene RIF (15)

PMID Text
24623090 Japanese encephalitis virus infected cells through three virus receptors: DC-SIGN, DC-SIGNR and LSECtin.
22842622 LSECtin binds to soluble human immunodeficiency virus type-1 (HIV-1) GP120
22711492 The mobility of LSECtin-carbohydrate recognition domain increased after addition of Ca(2+) and N-acetylglucosamine.
22637699 The results indicate that LSECtin plays an important role in colorectal carcinoma liver metastasis and may be a promising new target for intervention in metastasis formation.
22156524 Axl,Tyro3,DC-SIGN and LSECtin are identified as new virus receptors for Lassa virus cell entry.
21257728 The human LSECtin have been shown to bind Ebola virus glycoprotein with equivalent affinities, and the GlcNAcbeta1-2Man disaccharide has been demonstrated to be an effective inhibitor of this interaction.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20127679 The interaction between CD44 & LSECtin is dependent on protein-glycan recognition. CD44 is the 1st identified endogenous ligand of LSECtin, & similarly, LSECtin is a novel ligand of CD44.
19632227 Liver sinusoidal endothelial cell lectin, LSECtin, negatively regulates hepatic T-cell immune response.
19111020 LSECtin is expressed by liver myeloid cells, and its expression is dependent on the PU.1 transcription factor.
18697825 Observational study of gene-disease association. (HuGE Navigator)
18083206 Our results reveal important differences between Ebola virus and HIV-1 capture by DC-SIGN/R and LSECtin and hint towards different biological functions of these lectins.
18083206 LSECtin binds to soluble human immunodeficiency virus type-1 (HIV-1) GP120
17339424 LSECtin is a pathogen-associated molecular pattern receptor in human myeloid cells; results suggest that LSECtin participates in antigen uptake and internalization
14711836 results indicate that LSECtin is a novel member of a family of proteins comprising CD23, DC-SIGN, and DC-SIGNR and might function in vivo as a lectin receptor

AA Sequence

MDTTRYSKWGGSSEEVPGGPWGRWVHWSRRPLFLALAVLVTTVLWAVILSILLSKASTERAALLDGHDLL      1 - 70
RTNASKQTAALGALKEEVGDCHSCCSGTQAQLQTTRAELGEAQAKLMEQESALRELRERVTQGLAEAGRG     71 - 140
REDVRTELFRALEAVRLQNNSCEPCPTSWLSFEGSCYFFSVPKTTWAAAQDHCADASAHLVIVGGLDEQG    141 - 210
FLTRNTRGRGYWLGLRAVRHLGKVQGYQWVDGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDS    211 - 280
EKDGWICEKRHNC                                                             281 - 293
//

Text Mined References (20)

PMID Year Title
24623090 2014 Distinct usage of three C-type lectins by Japanese encephalitis virus: DC-SIGN, DC-SIGNR, and LSECtin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22711492 2012 Mobility study of individual residue sites in the carbohydrate recognition domain of LSECtin using SDSL-EPR technique.
22673088 2012 Cell surface molecules involved in infection mediated by lymphocytic choriomeningitis virus glycoprotein.
22637699 2013 Novel roles of liver sinusoidal endothelial cell lectin in colon carcinoma cell adhesion, migration and in-vivo metastasis to the liver.
22156524 2012 Identification of cell surface molecules involved in dystroglycan-independent Lassa virus cell entry.
21257728 2011 Mouse LSECtin as a model for a human Ebola virus receptor.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20127679 2010 The DC-SIGN family member LSECtin is a novel ligand of CD44 on activated T cells.
19632227 2009 Liver sinusoidal endothelial cell lectin, LSECtin, negatively regulates hepatic T-cell immune response.
19111020 2009 The pathogen receptor liver and lymph node sinusoidal endotelial cell C-type lectin is expressed in human Kupffer cells and regulated by PU.1.
18697825 2008 Polymorphisms in the C-type lectin genes cluster in chromosome 19 and predisposition to severe acute respiratory syndrome coronavirus (SARS-CoV) infection.
18624398 2008 Protein interaction data set highlighted with human Ras-MAPK/PI3K signaling pathways.
18083206 2008 Interactions of LSECtin and DC-SIGN/DC-SIGNR with viral ligands: Differential pH dependence, internalization and virion binding.
17339424 2007 The DC-SIGN-related lectin LSECtin mediates antigen capture and pathogen binding by human myeloid cells.
16051304 2005 LSECtin interacts with filovirus glycoproteins and the spike protein of SARS coronavirus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14711836 2004 Characterization of a novel C-type lectin-like gene, LSECtin: demonstration of carbohydrate binding and expression in sinusoidal endothelial cells of liver and lymph node.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.