Property Summary

NCBI Gene PubMed Count 17
PubMed Score 18.25
PubTator Score 19.08

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 3.6e-06
atypical teratoid / rhabdoid tumor -1.200 1.3e-07
glioblastoma -1.200 6.5e-06
interstitial cystitis 1.500 9.8e-04
osteosarcoma -1.874 1.9e-05
primitive neuroectodermal tumor -1.300 5.0e-05
psoriasis 1.100 6.5e-10
sonic hedgehog group medulloblastoma -1.100 7.4e-04

Gene RIF (15)

AA Sequence

MDTTRYSKWGGSSEEVPGGPWGRWVHWSRRPLFLALAVLVTTVLWAVILSILLSKASTERAALLDGHDLL      1 - 70
RTNASKQTAALGALKEEVGDCHSCCSGTQAQLQTTRAELGEAQAKLMEQESALRELRERVTQGLAEAGRG     71 - 140
REDVRTELFRALEAVRLQNNSCEPCPTSWLSFEGSCYFFSVPKTTWAAAQDHCADASAHLVIVGGLDEQG    141 - 210
FLTRNTRGRGYWLGLRAVRHLGKVQGYQWVDGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDS    211 - 280
EKDGWICEKRHNC                                                             281 - 293
//

Text Mined References (20)

PMID Year Title