Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.15
PubTator Score 19.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.874 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.200 0.000
primitive neuroectodermal tumor -1.300 0.000
interstitial cystitis 1.500 0.001
pilocytic astrocytoma -1.100 0.000
sonic hedgehog group medulloblastoma -1.100 0.001
psoriasis 1.100 0.000

Synonym

Accession Q6UXB4
Symbols LP2698
UNQ431
DTTR431
LSECtin

Gene

Gene RIF (15)

PMID Text
24623090 Japanese encephalitis virus infected cells through three virus receptors: DC-SIGN, DC-SIGNR and LSECtin.
22842622 LSECtin binds to soluble human immunodeficiency virus type-1 (HIV-1) GP120
22711492 The mobility of LSECtin-carbohydrate recognition domain increased after addition of Ca(2+) and N-acetylglucosamine.
22637699 The results indicate that LSECtin plays an important role in colorectal carcinoma liver metastasis and may be a promising new target for intervention in metastasis formation.
22156524 Axl,Tyro3,DC-SIGN and LSECtin are identified as new virus receptors for Lassa virus cell entry.
21257728 The human LSECtin have been shown to bind Ebola virus glycoprotein with equivalent affinities, and the GlcNAcbeta1-2Man disaccharide has been demonstrated to be an effective inhibitor of this interaction.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20127679 The interaction between CD44 & LSECtin is dependent on protein-glycan recognition. CD44 is the 1st identified endogenous ligand of LSECtin, & similarly, LSECtin is a novel ligand of CD44.
19632227 Liver sinusoidal endothelial cell lectin, LSECtin, negatively regulates hepatic T-cell immune response.
19111020 LSECtin is expressed by liver myeloid cells, and its expression is dependent on the PU.1 transcription factor.
More...

AA Sequence

MDTTRYSKWGGSSEEVPGGPWGRWVHWSRRPLFLALAVLVTTVLWAVILSILLSKASTERAALLDGHDLL      1 - 70
RTNASKQTAALGALKEEVGDCHSCCSGTQAQLQTTRAELGEAQAKLMEQESALRELRERVTQGLAEAGRG     71 - 140
REDVRTELFRALEAVRLQNNSCEPCPTSWLSFEGSCYFFSVPKTTWAAAQDHCADASAHLVIVGGLDEQG    141 - 210
FLTRNTRGRGYWLGLRAVRHLGKVQGYQWVDGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDS    211 - 280
EKDGWICEKRHNC                                                             281 - 293
//

Text Mined References (20)

PMID Year Title
24623090 2014 Distinct usage of three C-type lectins by Japanese encephalitis virus: DC-SIGN, DC-SIGNR, and LSECtin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22711492 2012 Mobility study of individual residue sites in the carbohydrate recognition domain of LSECtin using SDSL-EPR technique.
22673088 2012 Cell surface molecules involved in infection mediated by lymphocytic choriomeningitis virus glycoprotein.
22637699 2013 Novel roles of liver sinusoidal endothelial cell lectin in colon carcinoma cell adhesion, migration and in-vivo metastasis to the liver.
22156524 2012 Identification of cell surface molecules involved in dystroglycan-independent Lassa virus cell entry.
21257728 2011 Mouse LSECtin as a model for a human Ebola virus receptor.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20127679 2010 The DC-SIGN family member LSECtin is a novel ligand of CD44 on activated T cells.
19632227 2009 Liver sinusoidal endothelial cell lectin, LSECtin, negatively regulates hepatic T-cell immune response.
More...