Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.65
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Mal de Meleda 7 4.815 2.4

Expression

AA Sequence

MRGTRLALLALVLAACGELAPALRCYVCPEPTGVSDCVTIATCTTNETMCKTTLYSREIVYPFQGDSTVT      1 - 70
KSCASKCKPSDVDGIGQTLPVSCCNTELCNVDGAPALNSLHCGALTLLPLLSLRL                    71 - 125
//

Text Mined References (7)

PMID Year Title