Property Summary

NCBI Gene PubMed Count 16
Grant Count 8
R01 Count 4
Funding $484,067.83
PubMed Score 14.44
PubTator Score 15.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
non-small cell lung cancer -1.580 0.000
intraductal papillary-mucinous carcinoma... -2.600 0.001
non primary Sjogren syndrome sicca 1.200 0.028
nasopharyngeal carcinoma -2.200 0.000
lung carcinoma -3.900 0.000
ovarian cancer 1.700 0.000
Breast cancer 1.400 0.028
psoriasis 3.100 0.000

Gene RIF (9)

PMID Text
25411203 This article shows that GPR35 is the receptor of CXCL17.
25303284 CXCL17 production correlated with adverse immune infiltration and might be an important target for anti-HCC therapies.
22611239 We conclude that CXCL17 is an antimicrobial mucosal chemokine that may play a role in the pathogenesis of interstitial lung diseases
22425983 these results suggest that VCC-1 is involved in cisplatin-induced apoptosis of HepG2 cells, and also provides some evidence for VCC-1 as a potential cellular target for chemotherapy.
21586597 An Fc-fusion protein of 35kDa with a modified human immunoglobulin IgG1 Fc domain is capable of inhibiting CC chemokine-induced calcium flux, chemotaxis, and beta-arrestin recruitment in primary macrophages and transfected cells.
20955708 Immune surveillance occurs during the early intraepithelial stages of human pancreatic carcinogenesis and is mediated by expression of CXCL17 and ICAM2.
19657564 These results strongly suggest that VCC-1 plays an important role in hepatocellular carcinoma cell invasion and tumor growth.
16989774 VCC1 plays a role in angiogenesis and possibly in the development of tumors in some tissue types
16455961 DMC induces migration of monocytes and immature dendritic cells. Expression studies show that DMC is constitutively expressed in lung, suggesting a potential role for DMC in recruiting monocytes and dendritic cells from blood into lung parenchyma

AA Sequence

MKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGL      1 - 70
PKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL                          71 - 119
//

Text Mined References (20)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25411203 2015 Cutting edge: GPR35/CXCR8 is the receptor of the mucosal chemokine CXCL17.
25303284 2014 CXCL17 expression predicts poor prognosis and correlates with adverse immune infiltration in hepatocellular carcinoma.
24973458 2014 CXCL17 is a major chemotactic factor for lung macrophages.
23115081 2013 CXCL17, an orphan chemokine, acts as a novel angiogenic and anti-inflammatory factor.
22952881 2012 CXCL17 expression by tumor cells recruits CD11b+Gr1 high F4/80- cells and promotes tumor progression.
22611239 2012 CXCL17 is a mucosal chemokine elevated in idiopathic pulmonary fibrosis that exhibits broad antimicrobial activity.
22425983 2012 VCC-1 over-expression inhibits cisplatin-induced apoptosis in HepG2 cells.
21586597 2011 Site-directed mutagenesis of the CC chemokine binding protein 35K-Fc reveals residues essential for activity and mutations that increase the potency of CC chemokine blockade.
20955708 2011 CXCL17 and ICAM2 are associated with a potential anti-tumor immune response in early intraepithelial stages of human pancreatic carcinogenesis.
More...