Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.2e-22

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 5.2e-22

Gene RIF (1)

AA Sequence

MRPRCCILALVCWITVFLLQCSKGTTDAPVGSGLWLCQPTPRCGNKIYNPSEQCCYDDAILSLKETRRCG      1 - 70
STCTFWPCFELCCPESFGPQQKFLVKLRVLGMKSQCHLSPISRSCTRNRRHVLYP                    71 - 125
//

Text Mined References (8)

PMID Year Title