Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
oligodendroglioma 2849 1.8252926150973E-18
medulloblastoma 1524 1.94444104355269E-7
atypical teratoid / rhabdoid tumor 4369 5.6175658339246E-7
pilocytic astrocytoma 3086 1.92567345578846E-6
medulloblastoma, large-cell 6234 5.11512829612219E-6
posterior fossa group A ependymoma 1511 2.54608486956956E-5
glioblastoma 5572 3.8925425091402E-5
adult high grade glioma 2148 1.14344064129764E-4
osteosarcoma 7933 1.71537767351971E-4
ovarian cancer 8492 1.83014298965908E-4
Pick disease 1893 9.73816699785471E-4
astrocytic glioma 2241 0.00176885815256991
psoriasis 6685 0.0041470895929447
primitive neuroectodermal tumor 3031 0.00569080071494225
subependymal giant cell astrocytoma 2287 0.0300670338090859

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.700 0.002
oligodendroglioma -1.300 0.000
psoriasis -1.100 0.004
glioblastoma -2.100 0.000
osteosarcoma -1.206 0.000
medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -1.600 0.006
adult high grade glioma -2.300 0.000
pilocytic astrocytoma -1.900 0.000
posterior fossa group A ependymoma -1.100 0.000
subependymal giant cell astrocytoma -1.800 0.030
Pick disease -1.200 0.001
ovarian cancer 1.200 0.000

Synonym

Accession Q6UXB0 D3DNT6 G5E9B1 Q8TA84
Symbols C3orf40
FLAT715
PRO1378

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

AA Sequence

MFLATLSFLLPFAHPFGTVSCEYMLGSPLSSLAQVNLSPFSHPKVHMDPNYCHPSTSLHLCSLAWSFTRL      1 - 70
LHPPLSPGISQVVKDHVTKPTAMAQGRVAHLIEWKGWSKPSDSPAALESAFSSYSDLSEGEQEARFAAGV     71 - 140
AEQFAIAEAKLRAWSSVDGEDSTDDSYDEDFAGGMDTDMAGQLPLGPHLQDLFTGHRFSRPVRQGSVEPE    141 - 210
SDCSQTVSPDTLCSSLCSLEDGLLGSPARLASQLLGDELLLAKLPPSRESAFRSLGPLEAQDSLYNSPLT    211 - 280
ESCLSPAEEEPAPCKDCQPLCPPLTGSWERQRQASDLASSGVVSLDEDEAEPEEQ                   281 - 335
//

Text Mined References (6)

PMID Year Title
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.