Property Summary

NCBI Gene PubMed Count 15
Grant Count 64
R01 Count 29
Funding $13,675,113.32
PubMed Score 584.41
PubTator Score 113.48

Knowledge Summary

Patent

No data available

Synonym

Accession Q6UXA7 B0S7V8 Q0EFA6 Q2L6G7 Q5SQ81 Q86Z05 Q9UIG3
Symbols STG

Gene

Gene RIF (3)

PMID Text
19851445 Observational study of gene-disease association. (HuGE Navigator)
19620980 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15217361 STG is expressed in taste buds, skin and tonsils, and does not associate with psoriasis in the Swedish population

AA Sequence

MQGRVAGSCAPLGLLLVCLHLPGLFARSIGVVEEKVSQNLGTNLPQLGQPSSTGPSNSEHPQPALDPRSN      1 - 70
DLARVPLKLSVPASDGFPPAGGSAVQRWPPSWGLPAMDSWPPEDPWQMMAAAAEDRLGEALPEELSYLSS     71 - 140
AAALAPGSGPLPGESSPDATGLSPKASLLHQDSESRRLPRSNSLGAGGKILSQRPPWSLIHRVLPDHPWG    141 - 210
TLNPSVSWGGGGPGTGWGTRPMPHPEGIWGINNQPPGTSWGNINRYPGGSWGNINRYPGGSWGNINRYPG    211 - 280
GSWGNIHLYPGINNPFPPGVLRPPGSSWNIPAGFPNPPSPRLQWG                             281 - 325
//

Text Mined References (16)

PMID Year Title
23326239 2013 A genome-wide integrative genomic study localizes genetic factors influencing antibodies against Epstein-Barr virus nuclear antigen 1 (EBNA-1).
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
21841780 2011 A genome-wide association study identifies two new risk loci for Graves' disease.
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
21323541 2011 Risk HLA-DQA1 and PLA(2)R1 alleles in idiopathic membranous nephropathy.
20639881 2010 Genome-wide association study of follicular lymphoma identifies a risk locus at 6p21.32.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19620980 2009 Genetic variants at 6p21.33 are associated with susceptibility to follicular lymphoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...