Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3578 2.5e-11
psoriasis 6694 6.0e-05

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 1.100 2.5e-11
psoriasis 1.700 6.0e-05

Gene RIF (2)

AA Sequence

MGQPWAAGSTDGAPAQLPLVLTALWAAAVGLELAYVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVG      1 - 70
LFLRSDPSIRGVMLAGRGLGQGWAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFGNYRPFL     71 - 140
CLLLHAAGVLLHVSVLLGPALSALLRAHTPLHMAALLLLPWLMLLTGRVSLAQFALAFVTDTCVAGALLC    141 - 210
GAGLLFHGMLLLRGQTTWEWARGQHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVG    211 - 280
HTAS                                                                      281 - 284
//

Text Mined References (7)

PMID Year Title