Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.31
PubTator Score 5.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ulcerative colitis 1819 2.1e-06
group 3 medulloblastoma 4104 8.5e-03

AA Sequence

MKGILVAGITAVLVAAVESLSCVQCNSWEKSCVNSIASECPSHANTSCISSSASSSLETPVRLYQNMFCS      1 - 70
AENCSEETHITAFTVHVSAEEHFHFVSQCCQGKECSNTSDALDPPLKNVSSNAECPACYESNGTSCHGKP     71 - 140
WKCYEEEQCVFLVAELKNDIESKSLVLKGCSNVSNATCQFLSGENKTLGGVIFRKFECANVNSLTPTSAP    141 - 210
TTSHNVGSKASLYLLALASLLLRGLLP                                               211 - 237
//

Text Mined References (4)

PMID Year Title