Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 5.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

AA Sequence

MKGILVAGITAVLVAAVESLSCVQCNSWEKSCVNSIASECPSHANTSCISSSASSSLETPVRLYQNMFCS      1 - 70
AENCSEETHITAFTVHVSAEEHFHFVSQCCQGKECSNTSDALDPPLKNVSSNAECPACYESNGTSCHGKP     71 - 140
WKCYEEEQCVFLVAELKNDIESKSLVLKGCSNVSNATCQFLSGENKTLGGVIFRKFECANVNSLTPTSAP    141 - 210
TTSHNVGSKASLYLLALASLLLRGLLP                                               211 - 237
//

Text Mined References (4)

PMID Year Title
27027293 2016 Lypd8 promotes the segregation of flagellated microbiota and colonic epithelia.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.