Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.60
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.41000371794806E-37
non-small cell lung cancer 2798 1.15545010453188E-15
atypical teratoid / rhabdoid tumor 4369 1.05716508580655E-11
psoriasis 6685 2.43766316340372E-10
group 4 medulloblastoma 1875 3.04524486641216E-6
primitive neuroectodermal tumor 3031 3.18944057771983E-6
medulloblastoma, large-cell 6234 4.09061788258474E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.96304244326052E-6
pediatric high grade glioma 2712 8.19002974623907E-5
lung adenocarcinoma 2714 1.11556912257839E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.66635803860098E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.92733607501421E-4
pilocytic astrocytoma 3086 0.00644146727099451
glioblastoma 5572 0.00762201705310162
interstitial cystitis 2299 0.00800200614133984
astrocytic glioma 2241 0.00984930553256576
subependymal giant cell astrocytoma 2287 0.0205098155197499
oligodendroglioma 2849 0.0278372887768661

Expression

Synonym

Accession Q6UX73 B4DUM5 Q8N2I3 Q8N4T1
Symbols

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20578903 characterization of C16orf89; mRNA and translated protein sequences (signal peptide, O-glycosylation sites); mRNA expression in various tissues primarily thyroid

AA Sequence

MASLGLLLLLLLTALPPLWSSSLPGLDTAESKATIADLILSALERATVFLEQRLPEINLDGMVGVRVLEE      1 - 70
QLKSVREKWAQEPLLQPLSLRVGMLGEKLEAAIQRSLHYLKLSDPKYLREFQLTLQPGFWKLPHAWIHTD     71 - 140
ASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLWARMR    141 - 210
GCTQGPLQQSQDYINLFCANMMDLNRRAEAIGYAYPTRDIFMENIMFCGMGGFSDFYKLRWLEAILSWQK    211 - 280
QQEGCFGEPDAEDEELSKAIQYQQHFSRRVKRREKQFPDSRSVAQAGVQWRNLGSLQPLPPGFKQFSCLI    281 - 350
LPSSWDYRSVPPYLANFYIFLVETGFHHVAHAGLELLISRDPPTSGSQSVGL                      351 - 402
//

Text Mined References (10)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20578903 2010 Initial characterization of C16orf89, a novel thyroid-specific gene.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15197164 2004 A transcript finishing initiative for closing gaps in the human transcriptome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.